SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4AQH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4AQH2
Domain Number 1 Region: 14-230
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-53
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4AQH2
Sequence length 280
Comment (tr|M4AQH2|M4AQH2_XIPMA) Si:ch73-15b2.5 {ECO:0000313|Ensembl:ENSXMAP00000016717} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
RLTSCTLWQDLEEVKASGLPNILTPKEIDLQESMFELIVSEVSYLKSLGVLVNHFYASKV
LKKTMSTMEHHTLFCNIRHVMEANTKFLLDLEARLGESLTIFQVGDIVLQHCGTFKRHYV
PYVINMTYQESLVNQLMQQNKNFVYVLKKLERDPVCQKQGLKSFLILPFQRITRIKLLLE
SILKLTEPDSEAASNLSKAIKGIHEIVLECDQKVEKMKRLEELIRLETLMDFDDIKLVPL
VKSTRFLVLHGPLDTVVTYGSKLSTVRIYLHLFNDLLIIS
Download sequence
Identical sequences M4AQH2
ENSXMAP00000016717 ENSXMAP00000016717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]