SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4AUW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4AUW4
Domain Number 1 Region: 542-588
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 
Domain Number 2 Region: 57-104
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000327
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 120-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000353
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 497-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000026
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4AUW4
Sequence length 589
Comment (tr|M4AUW4|M4AUW4_XIPMA) Complement component 8, beta polypeptide {ECO:0000313|Ensembl:ENSXMAP00000018259} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MFSVMMQPSRFSSHSCLLALTLSLVLLSEFPRTAASDENASVRETRSVGNRVVVQPVDCI
LSEWSRWSRCDTCTKKKYRYAKLEQPSQFGGEPCYLHGAQEERCEVPARYTCDSVPLCEG
FLCTQTTSRCVHRTLQCNGEDDCGDMSDEVGCTKTSKPCRVEAEEYWGIENLAKGINVLN
SHLEGVVLDNRYYGGGCLPHYIQDVPFRKPFNLQQYTLQTRGSYDFTLQSFESYSDYMDH
TFRERMTQTSFSIGFSVPGVFSFGFNYDSSKYSKSVSKIRRASGVTNSFIRAKAELELAQ
YILKSDGLVLHPEFLQRLRSLPQAYVYGEYRQIYKDYGTHYITEAALGGDFEHTTILNKE
KLEKSDYNLDQYKSCLQIGFKIGVTIEGVPVSLGLGGGSCSGLLNEMGEDTKNGAMVEDF
VAVVRGGNSESITALLSQKLPSEQLMRLWGEGVRYNPDFIRMTTKPLYELVTSRDFVQAD
SLKRNLKGALSEYLAETSACRCAPCHNNGVAVLKGTRCECVCPTGYTGRSCEITSRQKVL
GIDGGWSCWGAWSSCSGGQMTRSRQCSNPAPSSGGLPCRGLQQESTECF
Download sequence
Identical sequences M4AUW4
ENSXMAP00000018259 ENSXMAP00000018259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]