SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4AW38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4AW38
Domain Number 1 Region: 80-316
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-56
Family DBL homology domain (DH-domain) 0.0000302
Further Details:      
 
Domain Number 2 Region: 314-445
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-33
Family Pleckstrin-homology domain (PH domain) 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4AW38
Sequence length 931
Comment (tr|M4AW38|M4AW38_XIPMA) Rho/rac guanine nucleotide exchange factor (GEF) 18b {ECO:0000313|Ensembl:ENSXMAP00000018683} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
SPITCVSSLFPSAERPGQGERSGRSLPGDMDEIDSLRSKRCNDDAVSLAPSIAESIIVED
AHYAAVRADLESDAQDLEADSWSLAVDQYYLKKHSKDVVKRQDVIYELMQTEMHHVRTLK
IMLRVYVREMKENLQMDSGRLDCLFPRLENLLDLHTHFLSCLRERRRENLVSPSDRNYTI
NRVADILIAQFSGEIGERMKNCYGDFCSHHTEAVSLYKEMLQNNRRFQNLIRKISNLSIV
RRLGVTECILLVTQRITKYPVLVERILHNTEANTEEHQDLTRALSLIKDTIKEVDTLVNL
HEKESRLRDIHSKMEPKTQGKIKDDRVFRREDLAQGRRWLLHEGTVSWKAASGRLKVSDI
LAVLLSDVLLLLQEKDQRYVFATVDNKPSVISLQKLIVREVAHEEKAMFLICASSNEPEM
YEIHTASKEERNSWMTYIRQAVESCPHSEERLFSEEEEARAARLREFQERLSQRDAVIAQ
ALTEKLQLFAEMAGSVAGLEDTASRSKLLLRSDASDLQQGEVLLKGAITDVENLQNLLQA
GVKEEAQATQTEDGSVSGVLPRRAGTFGGYDSSPVILSKNGSAKKSFSGESRNRDRSQRA
SSDPQLKGLRGSHTLEQTVGAKQVHTQGVVLPSIIQQEFFDKVLMLSQRLYSLQAIVSQQ
DSQIELQKASLTERVSLPGRNKGNGLLEQEKQRTLALQREELAYLNKLQSQHRQEQQRWE
KERERHRQQVEATEARLQQREEECRKLEEQLAKEKEELDRQRETYQKDLERLRESTRAVE
KEKERLESQRKMKRKTIEPCCIMAVVFFQFRSVAHPLNCLNGDLISSSGLSSSTCVAELP
HSQKPLVRGSLSVAQADYPERPEIMLRRDTSSSTLPLPQKTEVPLHLFSTTNQQHKPVGV
QQQIPTKLAAINSGKGKGSKSGKASHRTDSS
Download sequence
Identical sequences M4AW38
ENSXMAP00000018683 ENSXMAP00000018683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]