SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4AXG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4AXG1
Domain Number 1 Region: 619-909
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-79
Family Protein kinases, catalytic subunit 0.00000000457
Further Details:      
 
Domain Number 2 Region: 26-199
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-70
Family Ephrin receptor ligand binding domain 0.00000217
Further Details:      
 
Domain Number 3 Region: 325-533
Classification Level Classification E-value
Superfamily Fibronectin type III 2e-31
Family Fibronectin type III 0.00019
Further Details:      
 
Domain Number 4 Region: 911-985
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.03e-20
Family SAM (sterile alpha motif) domain 0.00045
Further Details:      
 
Weak hits

Sequence:  M4AXG1
Domain Number - Region: 256-328,363-383
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000471
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4AXG1
Sequence length 989
Comment (tr|M4AXG1|M4AXG1_XIPMA) Eph receptor A6 {ECO:0000313|Ensembl:ENSXMAP00000019156} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MRSAGKYCVFLLLLKSVLADPGASNQVVLLDTTTVLGELDWKTFPVNGWDAITEMDEQNR
PIHTFQVCHVMEPNQNNWLRSGWIQRQAAQRVYVELRFTLRDCNSIPWVSGTCKETFNLF
YLQTDEPLPGGTRFRPTDYAKVDTIAADESFTQTDLGDRVLRLNTEVREVGPVTKKGFYL
AFQDVGACIALVSVKVFYKRCPSTLRNLAAFPDTVPHMDSSSLVEVRGTCVENAEERDTP
KLYCGADGDWLVPLGRCICSIGHEELDDHCRACKPGYFKAFAGNTKCSKCPQHSSSHDQA
ATICHCDKGFYRGIKDPSSMACTRPPSAPRNLISLINDTALFLQWMPPINTGGRSDITYN
VLCQRCDGGDVGVSQCEPCEPDLRFIPRPLGITGTSVAILDYAMHTNYTFHVEAVNGVSG
LGVAPRSLANVTVNTHQVGPAFVGIVRKDWATHNSIALSWSEVEQPPSDIVDYEVKYYEK
EQEQLSYSSTRTKSTRVVVTGLRPSTVYVFHVRARTSAGYTAYSPNFEFATAPEDSDIAD
QGQVLVVVTASVGGFSLLVILTLFLLITGRCQGYIKARMKSEDKRTRFHSGHVPFSGIKT
YVDPDTYEDPTQAVEEFAKEIDPSYICIDRVIGAGEFGEVCSGRLRIPGRKDVAVAIKTL
KGGYMEEQRREFLREASIIGQFNNSNIIRLEGVVTKSRPVMIVVEYMENGALDAFLRTRE
GQFTVLQLIGMLRGIAVGMSYLSDMGYVHRDLAARNILVDENLVCKVSDFGMSRILEDDS
ESAYTATGGKIPIRWTAPEAIAYGKFSSASDIWSYAIVMWEVMSYGERPYWEMSNQDVIL
SIEEGYRLPAPIGCPVTLHQLMLHCWQKEYSQRPSFNDVVSFLDKLIINPSSMLTLVNDA
LSFSDSPEEMPDYPLFISIGDWLDSIKMSQYKSNFLAAGYTTLDSIATMSIEDIKRIGVC
LIGHQRRIISSIQSLRLQLHHIHQSGFQV
Download sequence
Identical sequences M4AXG1
ENSXMAP00000019156 ENSXMAP00000019156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]