SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4BBJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4BBJ6
Domain Number 1 Region: 363-494
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.45e-25
Family Chaperone J-domain 0.00017
Further Details:      
 
Domain Number 2 Region: 19-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000269
Family DIX domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4BBJ6
Sequence length 497
Comment (tr|M4BBJ6|M4BBJ6_HYAAE) Uncharacterized protein {ECO:0000313|EnsemblProtists:HpaP803659} KW=Complete proteome; Reference proteome OX=559515 OS=(Peronospora arabidopsidis). GN= OC=Hyaloperonospora.
Sequence
METGVWAFYYVQGEEGEDSVHPNAFRLAGVLPGADVTLADVLQSFPLRNPWAFHFRFRLN
QGLNNGFYWLDVVQPKQQVPLASGRVVCKLLRLDRRPKAGLVFKRRPVLKWVDSSRPYND
QDTRTSAGRDKSSRNVMPADRGPSLVDSSSNSSSFHRSSSLPAFEQGRPAKYLDRPLSST
ATGADARHSNVSSRSSSISGEKKTVARPGAALNATVPGQEKLEDFLSGGQQVTGNSGAAA
ATTVTSAGIAVAAAAAVVVPNEDVNLMSDSGWHDAPATCNATSDFLNAMDPLAARVAPPT
QASHPGAVYREPLHFDDDNGQTVGPVTMAEMEAHSKSTSDGSNVYNPSLVDKSTKSDDVR
RAMEERERQVQRDVERAREDLRKREEAVHTMSAMKDTANAVIGPRLKSWAEDNGRVKNIR
TLLSTMHQVMWEDCKWSEVNMGKLIQPNDVKRYYRKAMIVVHPDKAGGRQAEQLLIAERV
FAALNTAWEDFQKSNPC
Download sequence
Identical sequences M4BBJ6
HpaP803659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]