SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4CJG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4CJG6
Domain Number 1 Region: 437-473,520-608
Classification Level Classification E-value
Superfamily TPR-like 0.00000345
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Weak hits

Sequence:  M4CJG6
Domain Number - Region: 343-470
Classification Level Classification E-value
Superfamily HCP-like 0.0549
Family HCP-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M4CJG6
Sequence length 745
Comment (tr|M4CJG6|M4CJG6_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra004350.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MASNYYSAQIKQCLEFGTRNQSRHLKTIHGHIIKTLPCPETILHNKIIHAYSKLRNSTYA
RRVFDEIPQPNLYSWNSLLMAYSQSGHHLSEMERTFKRLPERDGVSWNLLISGYSLSGLV
GEAVKAYNTMMKDGSGDFLTRVSVMTMLKLCSDNGRVGLGKQVHVQVVKRGFESYLLVGS
ALMDMYAKVGFISDAKTVFYGLEDRNTVMYNSLMGGLLASGMVEDAKKLFRGMEKDSVSW
TAMIKGLSQNGLEKEAIEFFREMKMEGLAMDQFTFGSVLPACGGLGAIEEGKKIHACVIR
TNFQDNIYVGSALVDMYCKCKCIDYAKTVFDGMRQKNVVSWTAMVVGYGQSGRAEEAVKM
FLEMQRSGIEPDHYTLGQAISACANISSLEEGSQFHGKAVVSGFVHYVIVSNSLVTLYGK
CGNIDDSTKLFNEMSFRDEVSWTAMVSAYAQFGRAIEAIDLFDRMVQHGLNPDGVTLTGV
ISACSRAGLVEKGQRYFELMTNEYGIVPSNGHYSCMIDLFSRSGRLEEAMNFINGMPFPP
DAIGWITLLSACRNKGNLEIGKRAAESLIELDPHHPAGYTLLLSIYASKGRWDCVAQLRR
KMREKNVRKEPGQSWIKWKGKLHSFSADDESSPYLDQIYAKLEELNQKIIEDGYKPDTSF
VQHDVEEAVKIKMLNYHSERLAIAFGLIFVPAGLPIRVGKNLRVCVDCHIATKHISRVTG
REIIVRDAVRFHRFKDGTCSCGDFW
Download sequence
Identical sequences M4CJG6
XP_009105448.1.100322 XP_018508888.1.100322 XP_018508889.1.100322 Bra004350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]