SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4CJY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4CJY0
Domain Number 1 Region: 144-322
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-38
Family BCR-homology GTPase activation domain (BH-domain) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4CJY0
Sequence length 446
Comment (tr|M4CJY0|M4CJY0_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra004514.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MTNFSRSKSTGTTKFPDVKTTRPGPDIYENIHHDDYDYEEEHSTTSTDYYDVSTPLSSHG
SRSGPGSGQYTILDIFAAVLKKSLVMSCTMERGDDDVAASMDIGWPTEVKHVSHVTFDRF
SGFLGLPSELEPEVPPQAPSASVSVFGVSAKSMQCSYDNRGNSIPTILLRMQKRLYSEGG
LKAEGIFRINPDNGKEEHVRKQLNRGVIPRGIDVHCLAGLIKAWFRELPTGVLDVLTPEQ
VMKCNTEDDCNKLVTLLPPVESALLDWAIGLMADVVEHEQFNKMNARNVAMVFAPNMTQM
ADPLTALIHAVQVMNFLKTLILMTLKERENADAKARWIEKQTSDPSEEWEQQHSEILAPE
KPNHNPKFLRVATLCRLEADNEEKFWNTEKRNDHKDTTESTGTVQRLCKHPLFKSSRSTK
KPLVSNHDEGRRGRDAWGSRLSSLPW
Download sequence
Identical sequences M4CJY0
Bra004514 XP_009142613.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]