SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4CWF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4CWF4
Domain Number 1 Region: 29-210
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.7e-69
Family Inorganic pyrophosphatase 0.00000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4CWF4
Sequence length 214
Comment (tr|M4CWF4|M4CWF4_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra008551.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MSEEVKENQSGKLQKPTPRLNERILSSLSKRSVAAHPWHDLEIGPGAPVIFNVVVEISKG
SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVIMQEPVLPGCFL
RARAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLTEIRRFFEDYKKNENK
EVAVNDFLPNGPAVEAIQYSMDLYAEYILHTLRR
Download sequence
Identical sequences A0A0D3AS94 M4CWF4
XP_009128516.1.100322 XP_013618648.1.26608 XP_013719426.1.73403 XP_013731710.1.73403 Bra008551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]