SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4D4H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4D4H8
Domain Number 1 Region: 310-413
Classification Level Classification E-value
Superfamily PH domain-like 0.0000288
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M4D4H8
Sequence length 427
Comment (tr|M4D4H8|M4D4H8_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra011382.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MTSLHKTLFTHNPTTLDQLMMCHTGKDSSWKKLENIEEEGPATVALEVKTALPPETPTET
MEFLGRSWSISAVELTKAFFNNSAADTNSFLLSTIVNTNKEVREDEEDSTSMASSRDLLL
PHIGNKTSPPISPRTGREMKHLYKSMVRGRTMGRRLKDQKEKKKQETRTRNAEIHAAVSV
AGVAAAVAANAASNAVAAAEHTVESTAVAAAVASAAALIASHCIEMAGEIGAGYNQIETA
VSSATNARTNGDVMALTASAATALRGAAILRARMERNNENKAMLYATKENVEREERNVFG
AMTFVSRGEELLKRTRKGDLHWKQVSFNINSNWQVVLKMKSKHVGGTFTKTKKCVVNGVC
RDIPEWAYRGGRVEKMVESRAYFGVKTVERVIEFECVNKKEKQMWIEGIQQLLSSLETGS
IVFTGKH
Download sequence
Identical sequences M4D4H8
XP_009125447.1.100322 XP_013666670.1.73403 Bra011382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]