SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4D8Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4D8Y6
Domain Number 1 Region: 133-292,339-367
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M4D8Y6
Sequence length 376
Comment (tr|M4D8Y6|M4D8Y6_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra012946.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MPSLISQQWQERTSGFFSSSGTKLREARQSAGAFVGEVAKDAKVNVSDVAERVGSLFKSR
WAILQQPATRHAVQEHLITAAATTGTLVRKGITETKEKVSVGKIKVEEAAKKTAQKSKTL
LTDIERWQKGVASSDVFGVAIEVTVQRQESTRPIPIIMIKCADYLILTGLNSPNLFKTEG
DKKLIQQLVSAYNQDPSASIPEGVNPVDVAALMKYYLASLPTPLTTFELYNEIKDARSSV
NRMRKSLQKLSSVNYNTLEFVTALLLRVSEKSQLNKMDSHSLAMEMAPVIMWREDKRPES
YREYWRRPSRSPKKSNDFETATPWDLLSDEGEGVDASSSISLDDIVQVDFGAVEVVQCLI
EHHNAIFTDADETVWR
Download sequence
Identical sequences M4D8Y6
Bra012946 XP_009136486.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]