SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4DEK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4DEK9
Domain Number 1 Region: 418-804
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.07e-90
Family Regulator of chromosome condensation RCC1 0.00039
Further Details:      
 
Domain Number 2 Region: 803-871
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.24e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 
Domain Number 3 Region: 252-332
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000111
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4DEK9
Sequence length 1270
Comment (tr|M4DEK9|M4DEK9_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra014931.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MWQVRSRFGLCLASSVLLEDGFLVVMPFSSFVPTLLFGGFSNLCGGVLRGSGARVVALLV
GVLPVLVVVTGDSASVSFCFSASCCGFFPKFLGTGVVALRCSVSFSYERWCFVTVSGSGW
VFDDEQTLVGLSAFLLAWWLFSGGGFSTGLTALYGLSGSTGVHGPGLDSWRQQSLVLFLE
RRHRRLCDPPRAAGFEPFGSRLQQGMRAPFSLVSRGNWMFILFTPSPLVLHCFINVYGMA
DPASYVYHERDIDQALIVLKKGTQLVKYSRKGKPKFRAFRLSPDEKTLIWFSHGEEKGLK
LSEVSRVVPGQRTICKDKAETEIWFAGLKYLIERSRNRRARSEIPEINDSDYFSTGRQSI
DVFPNNIPRGRTSIDLGSDVGYERGNMLRPSTDGFRISVSSTPSCSSGGSGPDDIESLGD
VYVWGEVWSDGILPDGTVTKETVKTDVLTPRPLESNVVLDVHQIVCGVRRVALVTRQGEL
FAWGGAAGGRLGHGIQVDISRPKLVEFLALTNIDFVACGEYHTCVVSTSGDLFSWGDGIH
NVGLLGHGSDISHWIPKRVSGPLEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGH
GNRESVSCPKEVQSLNGLKTVKVACNIWHTVAIVEVMGQTGTSMSSRKLFTWGDGDKNRL
GHGNKETYLLPTCVSSLIDYNFHQIACGHTFTVALTTSGHVFTMGGTSHGQLGNSISDGK
LPCLVQDRLVGEFVEEIACGDHHVAVLTSRSEVFTWGKGANGRLGHGDTDDRRTPTLVEA
LRDRHVKSLSCGSNFTSSICIHKWVSGADQSICSGCRQAFGFTRKRHNCYNCGLVHCHAC
SSKKALKAALAPTPGKPHRVCDACYSKLKAAESGYISNGNRTNVATPGRSMDGSVRIDKG
TTRSSKVLLTGNNTESGKTSRLGVRPDASSVRASQVPSLQQLKDIAFPTSLTAIQNALKP
VAPAAVPARLLAGPVASPPPARSSSPLPVRSSSPYARRSSPPRTSGFSRSVIDSLKKTNE
VMNQEMTKLQSQVKNLKQKCNNQGTEIQRFQKAAKEAFELAAKQSSKHKSATEALKSVAE
QLKGLKEKLPPEVSESEAFDSINSQAEAYLNANEVTETSLLTTSILDQQETSPTGNTQDQ
KIDEQVSSNSSISDTSNSSKPVPTESSSSSSSKTGGKESKEQFEPGVYVTFAVDVNGNKI
FRRVRFSKKRFDEHQAEDWWTKNKDRLLKWYSPNSSSSPVASDSSIAPPPPSEPPSDPSV
SEKDNEAEAD
Download sequence
Identical sequences M4DEK9
Bra014931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]