SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4DMJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4DMJ5
Domain Number 1 Region: 533-639,680-764
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.16e-28
Family Nuclease 0.062
Further Details:      
 
Domain Number 2 Region: 11-44,80-183
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.91e-25
Family Synaptotagmin-like (S variant) 0.056
Further Details:      
 
Domain Number 3 Region: 205-381,407-445
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.19e-22
Family Phospholipase D 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M4DMJ5
Sequence length 839
Comment (tr|M4DMJ5|M4DMJ5_BRARP) Phospholipase D {ECO:0000256|PIRNR:PIRNR036470} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MAEKPSDDVMLLHGDLDLTIVQARKLPNMDTFSNHLRLCLTVCTNPSTADEEEDRRARDG
LPPPPQPQPSNARSHRKVITSDPYVTVVVPQATLARTRVLKNSQDPKWDEHFTISIAHPM
SHLEFQVKDDDVFGAQIIGTAKIPVKDIASGSPVKGWFPILGASGKPPKKETALYIEMTF
TPFDQIHTYRSGIAGDPDRKGVKGTYFPVRKGSQVRLYQDAHVMDGMLPEIGLDGGKVYQ
HGKCWEDICYAVSEAHHMIYVVGWSVFHKVKLVREPTRKLPRGGDLTLGELLKYKSEEGV
RVLLLVWDDKTSHDKFGIRTPGVMGTHDEETRKFFKHSSVICVLSPRYASNTQAAGNNRK
VTAFLGGIDLCDGRYDTPEHRILHDLDTVFKDDFHNPTYPVGTKAPRQPWHDLHCRLEGP
AAYDVLMNFEQRWRKATRWKEFSLRLKGKTHWQDDALIRIGRISWILSPVFKYLKDGTNM
VPEDDPIVYVSKEDDPENWHVQVFRSIDSGSLKGFPKYEDEAKLQNLESAKRLVVDKSIQ
TAYIQTIRSAQHFIYIENQYFLGSSYAWPNYKDAGADNLIPMELALKIVSKIRAKERFAV
YVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYDVIARELKAVQSDAHPLDYLNFYCLGKR
EPLPEDMADTNGSAESDSYRFRRFMIYVHAKGMIVDDEYVLIGSANINQRSMAGTKDTEI
AMGAYQPHHTWTNKGKHPRGQVYGYRMSLWAEHLGKTGDEFVEPGDLECVRNVNEIAEGN
WKTFIDSNFSELQGHLIKYPLQVDVDGKVSSLPDYDSFPDVGGKIIGAHSMALPDTLTT
Download sequence
Identical sequences M4DMJ5
Bra017730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]