SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4DPR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4DPR1
Domain Number 1 Region: 101-167
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000197
Family PDI-like 0.042
Further Details:      
 
Domain Number 2 Region: 30-86
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000572
Family N-type ATP pyrophosphatases 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M4DPR1
Sequence length 172
Comment (tr|M4DPR1|M4DPR1_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra018502.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MGGKRESYGLMNTRTVDEEKSGRRKSLVAERIAREKKRNVDPVFQGLDGGAGSLVKWNPV
ANVERNHVWSFLRAMDVPVNTLHAKGSMDCCVVCSLVSLLSYAELADKLAGSGVKVVKFR
ADGDQKEFAKQELQLGSFPTILVFPKNSSRPIKDPSEKRDVDSLTLFFNLVR
Download sequence
Identical sequences M4DPR1
Bra018502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]