SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4DQ42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4DQ42
Domain Number 1 Region: 42-156
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-24
Family BCR-homology GTPase activation domain (BH-domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4DQ42
Sequence length 293
Comment (tr|M4DQ42|M4DQ42_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra018633.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MDIGGPTDVQHVAHVTFDRFNGFLGLPSEFEPDVPKKAPSARITGENSEEEYVREQLNKG
MIPDGIDVHCLAGLIKAWFRELPRGVLDPLPSEQVLQCESDEDFIKVVRLLPQTEASLLN
WAINLMADVVQFENVNKMNSRNLALVFAPNMSQCLTEKALREREVTSPPVDTRSSNEAED
GEKEVDNEEEDEEEEEGDGDGDGVYIIEEVDSEAEGGEKEVDKEEEEEEEEEQDGDGVYI
IEEEALQITRVVADDHKSESMKSAYDGSITSDSKGVDGVVQPLICNPDHIGNK
Download sequence
Identical sequences M4DQ42
Bra018633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]