SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4DRS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4DRS5
Domain Number 1 Region: 229-422
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.1e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.0021
Further Details:      
 
Domain Number 2 Region: 83-181
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000063
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4DRS5
Sequence length 913
Comment (tr|M4DRS5|M4DRS5_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra019218.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MANRNGESSSSQPPQFQPQQQNANEQDPEHHSGNADPRSRGGNTAVLAVEAIISPPSVSF
SNLCYFDCLQKQEFRSSFLEGLGWTSWKKRWFILTRTSLVFFRSDPSAVQQRGGEVNLTL
GGIDLNSSGSVVVKADKKLLTVLFPDGRDGRAFTLKADTMEDLHEWKAALEHALTQAPSA
SHVMGQNGIFRNDQSDAPAGVDEHRDEAPARPTVLGRPVLLALEDVDGTPSFLEKALRFV
EDHGVNTEGILRRAADVDDVEHRIREYEQGKNEFSPTEDAHVIADCLKYFLRELPSSPVP
ASCCNALLEACRTLRGNRVNAMREAICESFPEPNRRLLQRILMMMQLVASNKNVNRMNTN
AVAACMAPLLLRPLLAGDCNIENDFDVGGDGSMQLLQAAAAANHAQAIVITLLEEYESIF
GEGSLSAGLYSDSEESGSETEEGTDDGDYDDEDYDGTQGSDDYTDEEEGFENESDRSYSE
SEASAETPHDHKARPSIQITEITSSESTPKGSTQPKVPKKLLSSSKRSSLPRHEHARKDE
NILVKGSDSAQVKAVLGVSKAEDKNSSTTLSSAPGGSKRLWGRAHGRKNLSMESIDFTLE
VDEDDADIERLESTKSELQNRIADEVKNNAVLQASLERRKKALYVRRQALENDVERLQEQ
LQQEIDRKSALESGLNMSKGNQTIPETTDEKLKKDLQEVAQAEADIVNLEHKVDDLENRL
GQQDVKGSGSPHGGSRESRRSPEHNSKMKEKQKDTEAASGNVLQDGQGSARENEIEKIQD
PRSKSSQQTSKVAGMSKRSGTKGEGNTTTTTSALSKLTMRLNFLKERRSQIANELSNMDK
GKSSSGQPSPSTEQNRSVQETERETGSKSNQNQDSDSSKLQSPHVLDRGRSDNGGDRGKG
GNQPSTTPRTLSR
Download sequence
Identical sequences M4DRS5
Bra019218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]