SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4DTV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4DTV7
Domain Number 1 Region: 36-312
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.81e-32
Family G proteins 0.001
Further Details:      
 
Domain Number 2 Region: 568-691
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-21
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M4DTV7
Sequence length 939
Comment (tr|M4DTV7|M4DTV7_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra019950.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MEAIDELSQLSDSMKQAASLLADEDPDETSSSRRPATFLNVVALGNVGAGKSAVLNSLIG
HPVLPTGENGATRAPIIIDLSREASLSSKAIILQIDSKSQQVSASALRHSLQDRLSKGAS
GKNRDQIYLNLRTSTAPPLKLVDLPGLDQRIVDDSMIAEYAQHNDAILLVIVPASQASEI
SSSRALKIAKEHDPESTRTVGIIGKIDQAAENPKALAAVQALLSNQGPPKTTDIPWVALI
GQSVAIASAQSGSGENSLETAWRAESESLKSILTGAPQSKLGRVALVDTLASQIRSRMKL
RLPSILSGLQGKSQIVQNELARLGEQLVNSAEGTRAIALELCREFEEKFLLHLAGGGGSG
WKVVASFEGNFPNRIKQLPLDRHFDLNNVKRVVLEADGYQPYLISPEKGLRSLIKIVLEL
AKDPARLCVDEVHRVLVDIVSASANATPGLGRYPPFKREVVAIASAALDGFKNEAKKMVV
ALVDMERAFVPPQHFIRLVQRRMERQRREDELKGRSSKKGQDAEQSLLSRAASPQPDGSM
KSMKDKPSPQDKETPEVSGLKTAGPEGEITAGYLMKKSAKTNGWSRRWFVLNEKTGKLGY
TKKQEERNFRGTITLEECTIEEIPEEEVEKSKSSKDKKANGPDPKGPGLIFKITCKVPYK
TVLKAHNSLVLKAESAVDKNEWINKLQKVIQARGGQVGNISMRQSFSEGSLDKMVRKPVD
PEEELRWMSQEVRGYVEAVLNSLAANVPKAVVLCQVEKSKEDMLNQLYSSIRFNIGPPPC
DEFHFSCGVLICALLYLIYSAIGNERIESLIQEDQNVKGKRERYLKQSSLLSKLTRQLSV
HDNRAAAASSWSDNGSTESSPKTSGGSSGDDWMNAFNAAGNGGSDSLSRYGSGGHSHSRR
YSDPAQNGDLPSPGSGSSRRTTPNRLPPAPPQGGSSYRY
Download sequence
Identical sequences M4DTV7
Bra019950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]