SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4E081 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4E081
Domain Number 1 Region: 299-489,527-573
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.65e-42
Family Phospholipase D 0.053
Further Details:      
 
Domain Number 2 Region: 707-809,864-916
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.14e-28
Family Nuclease 0.082
Further Details:      
 
Domain Number 3 Region: 209-317
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000364
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M4E081
Sequence length 1072
Comment (tr|M4E081|M4E081_BRARP) Phospholipase {ECO:0000256|PIRNR:PIRNR009376} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MASEQLMSPAGGGGGGGGGGGGGRYFQMQPEQIPSMVSSLFSFAPAPTQEANRIFEELPK
AVIVSVSRPDASDISPVLLSYTIECQYKQASVKEWLQNLGIGDHAPIVQDEDVDEVQLHQ
EESAKNRDVPSSAALPVIRPLGRQQSISVRGKHAMQEYLNHFLGNLDIVNSREVCRFLEV
SMLSFSPEYGPKLKEDYIMVKHLPKISKSDDSDRCCGCCWFCCCNDNWQKVWGVLKPGFL
ALLEDPFDPKLLDIIVFDVLPVSNGNDGADVSLAVELKDHNPLRHAFKVTSGNRSIRIRA
KSSAKVKDWVASINDAALRPPEGWCHPHRFGSFAPPRGLTDDGSQAQWFVDGGAAFAAMA
AAIENAKSEIFICGWWVCPELYLRRPYDSHTSSRLDNLLENKAKQGVQIYILIYKEVALA
LKINSVYSKRRLLSIHENVRVLRYPDHFSSGVYLWSHHEKLVIVDHQVCFIGGLDLCFGR
YDTFEHKVGDNPSVTWPGKDYYNPRESEPNTWEDALKDELDRRKYPRMPWHDVHCALWGP
PCRDVARHFVQRWNYAKRNKAPYEDSIPLLMPQHHMVIPHYMGRQEESDIECKNDEDSIK
GIRREDSFSSGSSLQDIPLLLPQEPVDEDGSSRGHKANGTNSRNGPFSFRKSKIEPVVGD
TPMRGFVDDRNGLHLPVAKRGSNSIDSEWWETQERGYQVGSPDESGQVGPRTSCRCQIIR
SVSQWSAGTSQVEESIHSAYRSLIDKAEHFIYIENQFFISGLSGDDTIKNRVLEALYKRI
LRAHNEKKSFRVVVVIPLLPGFQGGIDDSGAASVRAIMHWQYRTMYRGHNSILNNLYKTV
GPKANDYISFYGLRAYGKLSEDGPVATSQVYVHSKIMIIDDRAALIGSANINDRSLLGSR
DSEIGVLIEDKELVDSRMAGKPWKAGKFSLSLRLSLWSEHLGLRSGEIDQIIDPVSDSTY
KEIWMATAKTNTMIYQDVFSCVPNDLIHSRMAFRQSISYWKEKLGHTTIDLGIAPEKLES
YHNGDIKRSDPMDRLKSIKGHLVSFPLDFMCKEDLRPFFNESEYYASAQVFH
Download sequence
Identical sequences M4E081
Bra022178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]