SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4EH65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4EH65
Domain Number 1 Region: 63-194
Classification Level Classification E-value
Superfamily TPR-like 2.57e-19
Family Tetratricopeptide repeat (TPR) 0.0087
Further Details:      
 
Domain Number 2 Region: 206-280
Classification Level Classification E-value
Superfamily TPR-like 0.0000384
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4EH65
Sequence length 472
Comment (tr|M4EH65|M4EH65_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra028130.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MIFCHVMIDCNIPLLFSSAILGFCGNVALAEDDPIKPRSGDSTDGSGLERIEDGSVVSNI
HTSKWRVFTDSGREHFFQGKLEPAERLFGSAIQEAKEGFGERDPHVASACNNLAELYRVK
KEFDKAEPLYLEAVSILEEYYGPEDVRVGATLHNLGQLYLVQRKLEEARSCYEMKRRVLG
HNHPDYAETMYHLGTDNGQGESMTYIRRLRYLSQIYIRSSRLADAENIQRKLLHMMELSK
GWNSMETVIAAEALAVTLQLSGQLSEAQELFEKCLNTQKKLLPEGHIQIGGNFLHMAKTF
MLQATQLRGTDNSEALSKLEKAKNYLGDSSRIAKDVLLKLKNQKGKEQKQGKSSETLRNY
EHAALVILLRSLESLAVLETSKNEIPEAKERDPHAAEDALLQCLSAYKEFGCGSQLQDSP
EVKTEYVTCLKHLSVLLANKETMEASPISIAELKEEVKRIEMDLLGSHKKGS
Download sequence
Identical sequences M4EH65
Bra028130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]