SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4ELR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4ELR7
Domain Number 1 Region: 17-94
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.93e-27
Family Chaperone J-domain 0.00021
Further Details:      
 
Domain Number 2 Region: 212-323
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000036
Family Calsequestrin 0.07
Further Details:      
 
Weak hits

Sequence:  M4ELR7
Domain Number - Region: 456-582
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000136
Family Calsequestrin 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4ELR7
Sequence length 591
Comment (tr|M4ELR7|M4ELR7_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra029736.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MVRTQLVVSVVLVSTLLLLNTEAKTVDPYKVLGVSRDAKPREIQKAFHKQSLKYHPDKNK
NKGAQEKFAEINNAYEILSDEEKRKNYDLYGDEKGQPGFGSGFPGGNGGGYSYSSGGGQG
GGFNFGGPGGWQNMGGGGGGGGGSKSFSFSFGGGGGGPSASGSSFGFGMDDIFSMFGGGG
GGAKGRDQFGGFGGFGGGSSKAESGSKRGSVATVKTVTSQVYKKDIVDQGMTWLLLSYLP
SQRGTQYHESVIEEVAESLQGALKVGRINCETESSLCKQLGVVPRRAPRLFVYSYTSSGK
ATLAEYTEELVAKKVKSFCQEHLPRFSKRVDLNTFDVSAISSQGIPRVMLLSTKKDTPVI
WRVLSGLYNGRFVFYNTEVHDASDPKVKNLGVDAFPAIVGWSSNGEKQVLKTGITVKNLK
TAVQEIGKLLEAFEKKNKKASSNSQSGQAKSEPVEKIHLLSRTNFDSICGEKVPVCIIGA
FRSSQGKEKLHSILSKVSQKSLSRRQASGTGSQDTVSYSLVDAEKQSSFLSSFDKSEFKA
SDKVLIAYKPKRGKFATFKGDMTMEEAEKFVAAVLNGDVQFSKTRQKPQIK
Download sequence
Identical sequences M4ELR7
Bra029736 XP_009146966.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]