SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4ESZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M4ESZ3
Domain Number - Region: 448-617
Classification Level Classification E-value
Superfamily TPR-like 0.000278
Family HAT/Suf repeat 0.055
Further Details:      
 
Domain Number - Region: 250-339
Classification Level Classification E-value
Superfamily TPR-like 0.0266
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4ESZ3
Sequence length 716
Comment (tr|M4ESZ3|M4ESZ3_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra031923.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MLARSKLALHLSRRRSHPLPPPSRYLSSSNGDDQNDASSSDSANEWENLLKPYDLSSLST
SLPKITPSQLSTLLSLPLDVPTSLALFSRTGSQPGYRHTFLSYQSLIRKLGSQSQFEAID
TLLLQMKDEGICFKESIFISIMRDYARSNLPGQTIRLLLEMRSVFSCSPTFRSYNVVLEI
LVSAGCYKVAANVFDDMLSRRIPPTLFTFGVVIKALCAINEIDSGLSLLRDMTKHGCVPN
SVIYQTLIHSLSKCSRVNEALQLLEEMLLMGCVPDAETFNDVIFGLCKFERINEAAKMVN
RMLMRGFAPDDITYGYLMNGLCKIGRVDAAKDLFSRVPKPSIVIFNTLFHGFVTQGRLDD
AKSLLSDSHGLVPDVCTFNSLIYGYLKKGLVGLALEVFRDMGVRGCKPNIFSYTIFFDGF
CKLGRIDEAFDVLRDMSADGLKLNTAGYNCLISALCKEHRVTEAIDVFKEMPSKGCKPDA
YTFNTMIAGLCEVDEIDHALWLHRDMISEGVVANTVTYNTLIKAFLRRGEIKEARKLVSE
MVFQGSPLDEITYNGLIEGLCRAGEVDKARSLFEKMLRDGVVPSNISCNILINGLCRNGK
VEEAVEFQREMVHRGTTPDIVTFNSLINGLCRAGRIGDGVAMFEKLRDEGIWPDAVTYNT
LMSWLCKGGFVEDACFLLEEGVEEGFVPNFRSWSILLRSLVPQETLDRHRFYEVVL
Download sequence
Identical sequences M4ESZ3
Bra031923 XP_009130449.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]