SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4EZ83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4EZ83
Domain Number 1 Region: 220-499,538-657
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.21e-113
Family Myotubularin-like phosphatases 0.000000174
Further Details:      
 
Domain Number 2 Region: 55-179
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-19
Family GRAM domain 0.011
Further Details:      
 
Weak hits

Sequence:  M4EZ83
Domain Number - Region: 663-734
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.017
Family Sec2 N-terminal region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4EZ83
Sequence length 856
Comment (tr|M4EZ83|M4EZ83_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra034126.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MTPPRPPSGRQRPLRYYSDSERTEGGSGSWDTLEWNKLDQTASGSSSTSFANLSCLLESE
RVIVEGYGVVLINTDEAGTLLVTNFRILFLSEGTRKVIPLGTIPLATIEKFNKTALKVQS
NNRQSDKNPPRRLLQVTGKDMRIIVYGFRPKTKQRRSVFDALLRCTKPERVWDLYTFACG
PSKFGNANPKERLLNEYFRLLGKSSVRASMDMIEDGSFTLENELWRISDLNSNYNLCQTY
PFAFMVPKSISDEELLQACSFRAKCRLPVITWCQPGSGAVIARSSQPLVGLMMNMRSNFD
EKLVAAFCTQLGANKGERRKLYIADARPRKNALANGAMGGGSESSSNYFQSPIVFFGIDN
IHAMRESYSRLRDYLDMHGATSSDGRSSFLRHTGWTWGGGNLSSMSASVSLLGDSGWLIH
IQNVLAGAAWIAARVAVESASVLVHCSDGWDRTTQLVSLACLMLDPYYRTFAGFQALVEK
DWLAFGHPFSDRVGMPNISGSGNFDFPRQSSSAGSYPSSPVRQSTQSGASQSPSSSHAQN
NYSPIFTQWVDSVSQLMRMYPCAFEFSPTFLVDFMDCLLSCRFGNFLCNSEKERQQCAIA
EACGCIWAYLTDLRSLATTSHVHCNPFYDSLKYDGPLLPPAASLAPTLWPQFHLRWACPE
EAKAADIEVQCRAMRAKYSEMQKDKEATERRVDEISFAMESLSAELLRERRMSWSARESA
KRATKEYRALTRAVQSLGCKVNFTTSDVEDAPLETNNNNNNNNSRRRDRQGNNSDVSVSI
SLMSEENRSENQVGRVCEALCPLRTREGVCRWPEAGCAHLGRIKNSMEDVTFNRIKGDGG
HKYHQTVKRREHNGIN
Download sequence
Identical sequences M4EZ83
Bra034126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]