SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4EZE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4EZE1
Domain Number 1 Region: 122-300
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-36
Family BCR-homology GTPase activation domain (BH-domain) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M4EZE1
Sequence length 424
Comment (tr|M4EZE1|M4EZE1_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra034184.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MTGLVMVTKSTVGCGGGKGGGKTKSTVEEEEEQNQQQLSLVEFLLTALRKSVISCRVDNN
QQDDVVGGGGGISSAVHHMEIGWPTNVRHITHVTFDRFRGFLGLPHELQVEIPCRVPSAS
VSVFGVSAESMQCSYDNKGNSVPTILLLMQQRLYSQQGLKAEGIFRINPENSQEEHVRDQ
LNRGVVPENIDVHCLAALIKAWFRELPCGVLDGLSPEEVLNCNTEEESVELIKQLKPTES
ALLSWAVDLMADVVEEEELNKMNARNIAMVFAPNMTQMTDPLTALMHAVQVMNLLKTLIT
RTLGEREEASSGSEGYSPSHSSDSQTDSESDNAQDMEVSCESQGTDSESGGEEEQQEQQD
ENDTGSLSSIEDCFLSQLNDNARVSDTSMSEDLSPKGSPVVSLTDNKNNTLGSSTSDQDE
SMTV
Download sequence
Identical sequences M4EZE1
XP_009122165.1.100322 Bra034184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]