SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4FFX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M4FFX4
Domain Number - Region: 34-78
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0847
Family Polyphosphate kinase C-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M4FFX4
Sequence length 114
Comment (tr|M4FFX4|M4FFX4_BRARP) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bra039998.1-P} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MSPFSTLIVILVSSIMIHHLPLASSTQWCVASPTSKEKQLEENLGFACANGVDCRPILEG
GACYNPNTPLGHASYVMNAYYATHERTDYACKFFFPNSAMLTTTNPSYGSCVYA
Download sequence
Identical sequences A0A078IN52 M4FFX4
Bra039998 XP_013746046.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]