SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4FHF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4FHF3
Domain Number 1 Region: 337-497,540-586
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.01e-39
Family Phospholipase D 0.073
Further Details:      
 
Domain Number 2 Region: 680-896
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.2e-29
Family Nuclease 0.053
Further Details:      
 
Domain Number 3 Region: 240-335
Classification Level Classification E-value
Superfamily PH domain-like 0.000000132
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Weak hits

Sequence:  M4FHF3
Domain Number - Region: 46-101,165-200
Classification Level Classification E-value
Superfamily PX domain 0.0085
Family PX domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4FHF3
Sequence length 1047
Comment (tr|M4FHF3|M4FHF3_BRARP) Phospholipase {ECO:0000256|PIRNR:PIRNR009376} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MSTEKLLATNGVKSDGVIRRTAATANCLTGGSQIFEELPKAKIVSVSRPDTTDFSPLLLS
YTLELQYKQFKWTLQKKASQVLYLHFALKKRLIIEELHDKQEHVREWLHSLGIFDMQGSV
VQDDEEPDDGALPLHYTEDSVKNRNVPSRAALSIIRPTIGRSETVVDRGRAAMKGYLNLF
LGNLDIVNSKEVCKFLEVSRLSFAREYGSKMKEGYVTVKHLREVPGSDGGRCCLPSQCLG
CFGNSWAKVWAVLKPGFLALLEDPFSGKLLDIMVFDSLGFQGTKESPEQPRLAEQVKERN
PLRFGFKVTSGDRTVRLRTTSCRKVKEWVKAVDEAGSYNPHRFGSFAPPRGLTSDGSQAQ
WFVDGHTAFEAIAFAIQNATSEIFITGWWLCPELYLKRPFQDHPSLRLDALLETKAKQGV
KIYILMYKEVQIALKINSMYSKKRLQNIHKNVKVLRYPDHLSTGIYLWSHHDKIVIVDYQ
VCFIGGLDLCFGRYDTAEHKVGDCPPHIWPGKDYYNPRESEPNSWEETMKDELDRRKYPR
MPWHEVHCALWGPPCRDVARHFVQRWNHSKRNKAPNEQTIPLLMPHHHMVLPHYLGTREI
DIISTAKPEEDPNKPVVLSRQDSFSSASPPQDIPLLLPQETDADFATIGDIKFERGSRQA
LDGRDEYPGETSEESDRDETVNEWWWQIGKQSDCKCQIIRSVSQWSAGTNQPEDSIHQAY
CSLIENAEHFIYIENQFFISGLEKDDTILNRVSEALYRRILKAHEENKCFRVVIVIPLLP
GFQGGIDEFGAATVRALMHWQYRSISRDRTSILYNLKALLGPKTQDYISFYGLRSYGRLF
EDGPIATSQIYVHSKLLIVDDRIAVIGSSNINDRSLLGSRDSEIGVVIEDKEFVESSMNG
VKWMAGKFSYSLRCSLWSEHLGLQPGKVKMIEDPIKDATYQDLWMATAKRNTDIYDKVFS
CIPNENIRSKAALRHNVALCKDKLGHTTIDLGIAPEKLKPCDSDSWEMLKETRGHLVCFP
LHFMCNEEDLRPGFVETEFYTAPQVFH
Download sequence
Identical sequences A0A078G0I3 M4FHF3
XP_009124868.1.100322 Bra040531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]