SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M4ZVV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4ZVV8
Domain Number 1 Region: 9-264
Classification Level Classification E-value
Superfamily Cgl1923-like 1.18e-69
Family Cgl1923-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M4ZVV8
Sequence length 292
Comment (tr|M4ZVV8|M4ZVV8_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:BAN00818.1} KW=Complete proteome; Reference proteome OX=1313172 OS=Ilumatobacter coccineus YM16-304. GN=YM304_05040 OC=Acidimicrobiaceae; Ilumatobacter.
Sequence
MSFVGTEHVRWLAEPSLDRPVVVAAFTGWNDAGDAASSALTTMVESWGAEALAEIDPEAF
TDFATVRPQIKLDAENKRSIVWPTVGVWSASLPGTDVILVLGPEPALRWRLFSEQIVGIA
ERFGATMSISLGALLADVPHSRPVQLIGNATDNGLVERFELERSQYEGPTGIVGVLQDAL
STAGLPTASLWAAVPGYASQVPSPKAAMALVDRACSMIGTPAPLSRLASGAAEYEARVAA
LIGEDDDMAEYLHRLEQMADEQASPADDLTTADPVDPEQLMDEVEQFLRDQD
Download sequence
Identical sequences M4ZVV8
gi|470176712|ref|YP_007562756.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]