SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M5BXQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5BXQ4
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.53e-24
Family PHBH-like 0.00037
Further Details:      
 
Domain Number 2 Region: 100-189
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.6e-21
Family FAD-linked reductases, N-terminal domain 0.00047
Further Details:      
 
Domain Number 3 Region: 219-351
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000204
Family Glutathione peroxidase-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M5BXQ4
Sequence length 370
Comment (tr|M5BXQ4|M5BXQ4_THACB) Uncharacterized protein {ECO:0000313|EMBL:CCO32418.1} KW=Complete proteome; Reference proteome OX=1108050 OS=bottom rot fungus) (Rhizoctonia solani). GN=BN14_06478 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MVGETSDQVWGVVDVYIDTDFPDVRAVTAFENNGRRAMLIPRENDMVRFAIQISESDVSV
DPKTGRIDRTKIGAERIMELVKELIRPYRIEFKRVDWTGVHVIGQRLASRYQDENGRVFI
VGDACHTHSPHAGQGMNAAISDAHNLSWKLVHVLKGWGITDLLRTYESERRGFASQLIEL
HERIAEVMSGKVKGTSSDLIVHSIKFVCGTGIQYTDPTTIDSSNQSLAPGIVIGERFPHQ
VILRTADFRASSTLDLCKSDNIYKIVVLTGDPKHATQRQKLEQVGKSLNYWRLQRPDIFQ
VYTIMSTKKETGSYTDVPESLRPYWDTVFLDDVSYAESEGGGKAYQSFGTDTLRLWRRWR
KRRFWKHCVL
Download sequence
Identical sequences M5BXQ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]