SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M5FMW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5FMW7
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.24e-38
Family SCAN domain 0.0000462
Further Details:      
 
Domain Number 2 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.31e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 585-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 434-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 631-683
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-18
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 6 Region: 513-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000425
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 212-267
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000536
Family KRAB domain (Kruppel-associated box) 0.0052
Further Details:      
 
Domain Number 8 Region: 375-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000579
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M5FMW7
Sequence length 685
Comment (tr|M5FMW7|M5FMW7_BOVIN) Zinc finger protein 263 {ECO:0000313|EMBL:DAA15718.1} OX=9913 OS=Bos taurus (Bovine). GN=BOS_22623 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MASGPGFQDREGLLIVKLEEDSAWSQELPQPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLQPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
KELGRLRQKVTNRGRGTEMLLEEPLPLETAQESPSFKLEPMETERSPGRRLQELLGPGPK
RDPQTVKERALSAPWLSLFPPEGNMEDKELTGPQLPESLEDVAMYISQEEWGRQHPSKRA
LSRDTVQESYENVDSLESQVPSQEALSTQVEHGGKPWHPSVQTCKEGLSSRTPAPGEEKF
ENQEECAQSASPESIHCQALLPGQARGEVPWSPEQGRPRDRAEKLWEPPTEDRMEQSLVG
ATSCKKLGRPTELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVECAEIFGGNP
HFLSLHRAHLGEEAHKCLECGKSFSQNTHLTRHQRTHTGEKPYQCNVCGKSFSCNSNLHR
HQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCAECGKSFSRSSHLVIHERT
HEKERLYPFSECGEAVRDSTLFLTNPGTHPKAEKKLFQCLTCGKSFRQGMHLTRHQRTHT
GEKPYKCNLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGEKP
YKCSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences M5FMW7
XP_010817352.1.76553 XP_010817353.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]