SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M5VRN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5VRN1
Domain Number 1 Region: 128-225
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.37e-23
Family Thioltransferase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M5VRN1
Sequence length 258
Comment (tr|M5VRN1|M5VRN1_PRUPE) Uncharacterized protein {ECO:0000313|EMBL:EMJ03671.1} KW=Complete proteome; Reference proteome OX=3760 OS=Prunus persica (Peach) (Amygdalus persica). GN=PRUPE_7G145200 OC=Amygdaleae; Prunus.
Sequence
MARVASNPVGLHRFRPCFQVAQLPQHARTSLHFRNEHRRFPTVSCQQTPDPTETSTTEKS
IVEPGSGNDSSSQATSSSRDSGPPEFPNKNTNKQVALVSTLAALALFLSGRLDFGVSLKD
LSVAALPYEEALSNGKPTVVEFYADWCEVCKELAPDVYKVEQQYKGRVNFVMLNVDNTKW
EQELDEFGVEGIPHFAFLDKKGNEEGNVVGRLPEKYLLENVDALARGEASIPHARVVGQF
SSAEARKVHQVADPRSHG
Download sequence
Identical sequences M5VRN1
ppa010236m|PACid:17641001 XP_007202472.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]