SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M5W0P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5W0P5
Domain Number 1 Region: 76-190
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000549
Family Glutathione peroxidase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M5W0P5
Sequence length 265
Comment (tr|M5W0P5|M5W0P5_PRUPE) Uncharacterized protein {ECO:0000313|EMBL:EMJ06931.1} KW=Complete proteome; Reference proteome OX=3760 OS=Prunus persica (Peach) (Amygdalus persica). GN=PRUPE_6G216800 OC=Amygdaleae; Prunus.
Sequence
MALISPQILTLKSPSTPSLPSHSSLIAPSQSPSFSPPNTPRSPSLFCSPKSTTQYSSRRL
VVSRASTNASALDFSPSIGEVLGDVSIFTAAGDSVQFKDLWDLNEGVAVVALLRHFGCPC
CWELASALKESKARFDSAGVKIIAVGVGSPDKARILAERLPFPMDSLYADPDRKAYNVLG
LYYGLGRTFFNPASAKVFSRFEALQKAVKNYTIEATPDDRSSVLQQGGMFVFKGKQLLYA
RKDEGTGDHAPLDDILDVCCKVPVS
Download sequence
Identical sequences M5W0P5
ppa010087m|PACid:17654882 XP_007205732.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]