SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M5W830 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5W830
Domain Number 1 Region: 14-93
Classification Level Classification E-value
Superfamily Chaperone J-domain 6.93e-28
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 210-310
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000019
Family Calsequestrin 0.067
Further Details:      
 
Weak hits

Sequence:  M5W830
Domain Number - Region: 441-564
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000247
Family PDI-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M5W830
Sequence length 574
Comment (tr|M5W830|M5W830_PRUPE) Uncharacterized protein {ECO:0000313|EMBL:EMJ09907.1} KW=Complete proteome; Reference proteome OX=3760 OS=Prunus persica (Peach) (Amygdalus persica). GN=PRUPE_6G280600 OC=Amygdaleae; Prunus.
Sequence
MGNRLVLWIFLSALLFFLTMEATTIDPYKVLGVERNASQREIQKAFHKLSLQYHPDKNKN
KGAQAKFSEINNAYEILSDEEKRKNYDTYGDEKGSPGFGAGSPGDHGGYTYFTNGGPGKN
QFTYGPSDWQSMGGQGGSKSFSFSFGGPSGPSSFGFGMDDIFSNLFGGKPGGGGQFGGFS
GSTGSRPGSQPGSRGSPVSISAISSQVYKKEIVDQGMTWLLLSYTPSLKGHQHVESVIKE
VASSLQGALKIGSINCETEPSLCKDLGIYPRRMPRVFVYSYKVSERGSLVEYDGDWAAKP
LKMFCQDHLPRFSKRVDVKHFESSTVTVHKLPSVVLLSTKKDTPVIWRVLSGLHHNHFLF
YNAEVNDVSDPTVKKLGVDALPAIIGWLSNGEKHVLKAGITIKDMKSAINELSALLEGFE
KKNKKASSSQAKKSPTGEKQIPLLTESNFDALCGEKTPVCIIGAFRSSKERKKLESILNT
LSQKSLSRQQNSADGRDSISYTLLDASKKASFLNAFDKAGFKSLDKVLVAYKPRRGTFAV
FEGEMTTEEVERFIGSVLNGDIRFTKTRQKPVLK
Download sequence
Identical sequences M5W830
XP_007208708.1.23749 ppa003438m|PACid:17651662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]