SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M5XF89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5XF89
Domain Number 1 Region: 312-472
Classification Level Classification E-value
Superfamily eEF1-gamma domain 9.55e-62
Family eEF1-gamma domain 0.0000473
Further Details:      
 
Domain Number 2 Region: 123-264
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.21e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.0067
Further Details:      
 
Domain Number 3 Region: 46-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.74e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M5XF89
Sequence length 472
Comment (tr|M5XF89|M5XF89_PRUPE) Uncharacterized protein {ECO:0000313|EMBL:EMJ24126.1} KW=Complete proteome; Reference proteome OX=3760 OS=Prunus persica (Peach) (Amygdalus persica). GN=PRUPE_1G581500 OC=Amygdaleae; Prunus.
Sequence
MVIFSRNKNPSQHSLYCLLLSHSFASLVLSRKNAPPHRSQVRAKRFSAKAMALVLHAGKT
NKNAFKTLIVAEYTGVKVELAPDFEMGVTNKTPEYLKLNPIGKVPLLVTPDGPIFESNAI
ARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANIISWFRPRFGSAVYLPPAEEAA
ISALKRALGALNTHLASNTYLVGHFVTLADIIVTCNLLIGFTKLMTKSFTSEFPHVERYF
WTLVNQPNFKKVLGDVKQTESVPPVPSAKKPSQPKETKSKAKEEPKKEAKKEPAKPKAEA
AEEVEEAPKPKPKNPLDLLPPSGMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLW
FCEYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEI
PPFVMEECYDMELYNWTKVDLSDENQKERVNQMIEDQEPFEGEVLLDAKCFK
Download sequence
Identical sequences M5XF89
XP_007222927.1.23749 ppa005220m|PACid:17662951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]