SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M5XKC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5XKC3
Domain Number 1 Region: 176-332
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.94e-28
Family Thioltransferase 0.00074
Further Details:      
 
Domain Number 2 Region: 65-168
Classification Level Classification E-value
Superfamily TPR-like 1.38e-22
Family Tetratricopeptide repeat (TPR) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M5XKC3
Sequence length 336
Comment (tr|M5XKC3|M5XKC3_PRUPE) Uncharacterized protein {ECO:0000313|EMBL:EMJ19475.1} KW=Complete proteome; Reference proteome OX=3760 OS=Prunus persica (Peach) (Amygdalus persica). GN=PRUPE_2G018600 OC=Amygdaleae; Prunus.
Sequence
MDKVDEDMSDTKDHFDAKRPDPCRDNDEEIVESDIELDATDVVEPDNDPPQKMGNPSVEV
TEEMQDAAQIEKSKALDAISEGKLDEAIDHITEAIMLNPTSAILKATRASVFVKLNKPNA
AIRDANAALEINPDSAKGYKIRGMAKAMLGHWEEAASDLNVASKLDYDGEIGLVLKKVEP
NVRKIEEHRRKYERLHKEREIKSAERERKRQAEARERDALSALKDGEVIGIHSAKELETK
LNAASRTLRLAILYFTTKWCGACRVISPLYTSLAGKYPKAVFLKVDIDEARDVAADWNIG
SVPAFFFVRNGKEVDKMVGADKTALEGKIAQHAGST
Download sequence
Identical sequences M5XKC3
ppa008334m|PACid:17665242 XP_007218276.1.23749 XP_007218331.2.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]