SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M5XKH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5XKH2
Domain Number 1 Region: 169-325
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.84e-28
Family Thioltransferase 0.00074
Further Details:      
 
Domain Number 2 Region: 58-161
Classification Level Classification E-value
Superfamily TPR-like 1.36e-22
Family Tetratricopeptide repeat (TPR) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M5XKH2
Sequence length 329
Comment (tr|M5XKH2|M5XKH2_PRUPE) Uncharacterized protein {ECO:0000313|EMBL:EMJ19530.1} KW=Complete proteome; Reference proteome OX=3760 OS=Prunus persica (Peach) (Amygdalus persica). GN=PRUPE_2G018600 OC=Amygdaleae; Prunus.
Sequence
MSDTKDHFDAKRPDPCRDNDEEIVESDIELDATDVVEPDNDPPQKMGNPSVEVTEEMQDA
AQIEKSKALDAISEGKLDEAIDHITEAIMLNPTSAILKATRASVFVKLNKPNAAIRDANA
ALEINPDSAKGYKIRGMAKAMLGHWEEAASDLNVASKLDYDGEIGLVLKKVEPNVRKIEE
HRRKYERLHKEREIKSAERERKRQAEARERDALSALKDGEVIGIHSAKELETKLNAASRT
LRLAILYFTTKWCGACRVISPLYTSLAGKYPKAVFLKVDIDEARDVAADWNIGSVPAFFF
VRNGKEVDKMVGADKTALEGKIAQHAGST
Download sequence
Identical sequences M5XKH2
ppa008506m|PACid:17659561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]