SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M7AZ31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M7AZ31
Domain Number 1 Region: 159-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 606-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 327-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 270-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 496-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.94e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 438-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.26e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 382-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 550-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 214-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.65e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 10 Region: 23-82
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 11 Region: 121-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 12 Region: 652-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-17
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M7AZ31
Sequence length 706
Comment (tr|M7AZ31|M7AZ31_CHEMY) Uncharacterized protein {ECO:0000313|EMBL:EMP25068.1} KW=Complete proteome; Reference proteome OX=8469 OS=Chelonia mydas (Green sea-turtle) (Chelonia agassizi). GN=UY3_17872 OC=Chelonioidea; Cheloniidae; Chelonia.
Sequence
MGKRHGCFSGAGSGEQVLRGGLWLFQELVTFKEVAVYFTEEQWALLDPHQRALYRDVMQQ
NYENVTSLEDVSQSPEQREACERQQGNNPGMKLGKSTYQVGGLKDLKETTILPRVFSKEE
PYDCAECGRSFNRKSNLVRHQRVHTGEKPYNCPSCEKRFNQISNLIVHQRIHTGERPYKC
LNCEKNFKHSSDLVLHQRIHTGERPYKCPDCGKSFKQSSVLISHHTIHTGEKPHNCLECG
KYFAYFSSLISHQRIHTGERPYTCLDCGKTFRQKAYLIVHQRIHTGEAPYSCPECGKSFK
QRSDLSVHQRIHVADRPYKCPDCGKGFSQSSNLLKHQRVHTGERPYNCLECGKHFSNFSY
LISHRRIHTGERPYKCPDCGKSFRQSSDLSKHRRLHTGETPYKCSFCGKSFALSSNLISH
QRIHTGEASYKCANCRKSFKQSSDLISHRRIHTADRPYKCSVCGKSFSQRSNLTVHQKIH
TAARPYNCPDCGKSCKRSSELILHQRIHTGEKPFNCSKCGKSFCQRSHLIRHQRIHTGEK
PYKCCVCGKSFSQRSNLTVHQKIHTAARPHNCPECGKSCKRSSDLISHQKIHVGEKPHNC
PECGKSFKRSSQLISHQRIHTGEKPFNCSECGKSFCQRSHLIRHQRIHTGQKPFNCSECG
NNFIQSSALIVHQRMHTGNKPYTCSVCGKSYKVKVSLISHQKLHTG
Download sequence
Identical sequences M7AZ31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]