SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M7TTJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M7TTJ7
Domain Number 1 Region: 233-344
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.93e-29
Family Glutathione peroxidase-like 0.00072
Further Details:      
 
Domain Number 2 Region: 3-96
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.06e-28
Family PHBH-like 0.00042
Further Details:      
 
Domain Number 3 Region: 90-181
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.71e-19
Family FAD-linked reductases, N-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M7TTJ7
Sequence length 348
Comment (tr|M7TTJ7|M7TTJ7_EUTLA) Putative phenol 2-protein {ECO:0000313|EMBL:EMR69990.1} KW=Complete proteome; Reference proteome OX=1287681 OS=(Eutypa armeniacae). GN=UCREL1_2985 OC=Sordariomycetes; Xylariomycetidae; Xylariales; Diatrypaceae; Eutypa.
Sequence
MDGDSTNAVWGVMDIHVKTDFPDIRKKAVIHARSGNLMIIPREGDSMVRFYIELGQAVVK
DVTLAGLQDRARRIFSPFPVEFLETIWWSAYSIGQRIADNFTVGGRIFLTGDACHTHSPK
AGQGMNVSLQDGYNIGWKLAAILRGRASTRILDTYVSERQRTAADLIEFDRFFANLFSTS
YREKHGITSEEFKNQFVKAGQYTAGLATKYNQSLLVSQPPGNVQLAKNLTLASKLEEMSR
SFTPAGVDFNSIIQGVLVLASKRTNIEQADIPNFFTPATGRWKAKLFVDDESYNSGHGHA
YQAYGIDPEQGCLVIVRPDQYIAQVTSLDDFKNVLAFFEGFLISNSKR
Download sequence
Identical sequences M7TTJ7
XP_007790921.1.6650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]