SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M8BMI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8BMI2
Domain Number 1 Region: 258-395
Classification Level Classification E-value
Superfamily ApaG-like 3.53e-29
Family ApaG-like 0.00042
Further Details:      
 
Domain Number 2 Region: 50-159
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000798
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M8BMI2
Sequence length 395
Comment (tr|M8BMI2|M8BMI2_AEGTA) Uncharacterized protein {ECO:0000313|EMBL:EMT04207.1, ECO:0000313|EnsemblPlants:EMT04207} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_09125 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MADLAEGLGEGGPTVNSKNYRVFIANDAYKVWSESFGMYPLPLVKRVKLFWSSLKGWISE
NFPEALRTLSKGASEAQIRSAEDDLGFKLPMPTKLLYRFCNGQLPFSKNEDIRMAPLGII
GGYVFYNYNVNVHLSSLEQMVEETKEFNLHLEEQGLPIGPNLALVASSWYHPKTFLLNCS
SGDLYVGTANLSAGEMMPCVPESLIKPTNSDMPQDGLLLWLEEHLRRLQNGMIKIRPLST
SRYICLYPEASPLCSSAVTNGVKVRASAVFVPEHPRRGHLGTHLYSYSIRLSVPEACMLG
GVYFSSCQLHSRHWIIRCKDTVVSDMHGEGVIGEHPLLLPGQDEFVYESCTPLNGSSGSV
EGSFTFVPGRLTQPEGKPFDVTVAPFPLEVPDYIF
Download sequence
Identical sequences M8BMI2
EMT04207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]