SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9MS40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9MS40
Domain Number 1 Region: 945-1029
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 1.44e-34
Family Kix domain of CBP (creb binding protein) 0.0000207
Further Details:      
 
Domain Number 2 Region: 1695-1815
Classification Level Classification E-value
Superfamily Bromodomain 8.11e-34
Family Bromodomain 0.0000025
Further Details:      
 
Domain Number 3 Region: 509-602
Classification Level Classification E-value
Superfamily TAZ domain 2.88e-26
Family TAZ domain 0.0000745
Further Details:      
 
Domain Number 4 Region: 2397-2481
Classification Level Classification E-value
Superfamily TAZ domain 2.48e-22
Family TAZ domain 0.00000499
Further Details:      
 
Domain Number 5 Region: 2318-2378
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000271
Family ZZ domain 0.0016
Further Details:      
 
Weak hits

Sequence:  M9MS40
Domain Number - Region: 2816-2860
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.000114
Family Nuclear receptor coactivator interlocking domain 0.0027
Further Details:      
 
Domain Number - Region: 1908-1948
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000249
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M9MS40
Sequence length 3282
Comment (tr|M9MS40|M9MS40_DROME) Nejire, isoform C {ECO:0000313|EMBL:ADV37657.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG15319 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MMADHLDEPPQKRVKMDPTDISYFLEENLPDELVSSNSGWSDQLTGGAGGGNGGGGASGV
TTNPTSGPNPGGGPNKPAAQGPGSGTGGVGVGVNVGVGGVVGVGVVPSQMNGAGGGNGSG
TGGDDGSGNGSGAGNRISQMQHQQLQHLLQQQQQGQKGAMVVPGMQQLGSKSPNLQSPNQ
GGMQQVVGTQMGMVNSMPMSISNNGNNGMNAIPGMNTIAQGNLGNMVLTNSVGGGMGGMV
NHLKQQPGGGGGGMINSVSVPGGPGAGAGGVGAGGGGAVAANQGMHMQNGPMMGRMVGQQ
HMLRGPHLMGASGGAGGPGNGPGGGGPRMQNPNMQMNFRPFAAQLNSLPYGVGQYGGPGG
GNNPQQQQQQQQQQLLAQQMAQRGGVVPGMPQGNRPVGTVVPMSTLGGDGSGPAGQLVSG
NPQQQQMLAQQQTGAMGPRPPQPNQLLGHPGQQQQQQQQPGTSQQQQQQQGVGIGGAGVV
ANAGTVAGVPAVAGGGAGGAVQSSGPGGANRDVPDDRKRQIQQQLMLLLHAHKCNRRENL
NPNREVCNVNYCKAMKSVLAHMGTCKQSKDCTMQHCASSRQILLHYKTCQNSGCVICYPF
RQNHSVFQNANVPPGGGPAGIGGAPPGGGGAGGGAAGAGGNLQQQQQQQQQQQQNQQPNL
TGLVVDGKQGQQVAPGGGQNTAIVLPQQQGAGGAPGAPKTPADMVQQLTQQQQQQQQQVH
QQQVQQQELRRFDGMSQQVVAGGMQQQQQQGLPPVIRIQGAQPAVRVLGPGGPGGPSGPN
VLPNDVNSLHQQQQQMLQQQQQQGQNRRRGGLATMVEQQQQHQQQQQQPNPAQLGGNIPA
PLSVNVGGFGNTNFGGAAAGGAVGANDKQQLKVAQVHPQSHGVGAGGASAGAGASGGQVA
AGSSVLMPADTTGSGNAGNPNQNAGGVAGGAGGGNGGNTGPPGDNEKDWRESVTADLRNH
LVHKLVQAIFPTSDPTTMQDKRMHNLVSYAEKVEKDMYEMAKSRSEYYHLLAEKIYKIQK
ELEEKRLKRKEQHQQMLMQQQGVANPVAGGAAGGAGSAAGVAGGVVLPQQQQQQQQQQQQ
QGQQPLQSCIHPSISPMGGVMPPQQLRPQGPPGILGQQTAAGLGVGVGVTNNMVTMRSHS
PGGNMLALQQQQRMQFPQQQQQQPPGSGAGKMLVGPPGPSPGGMVVNPALSPYQTTNVLT
SPVPGQQQQQQFINANGGTGANPQLSEIMKQRHIHQQQQQQQQQQQQGMLLPQSPFSNST
PLQQQQQQQQQQQQQQQATSNSFSSPMQQQQQGQQQQQQKPGSVLNNMPPTPTSLEALNA
GAGAPGTGGSASNVTVSAPSPSPGFLSNGPSIGTPSNNNNNSSANNNPPSVSSLMQQPLS
NRPGTPPYIPASPVPATSASGLAASSTPASAAATCASSGSGSNSSSGATAAGASSTSSSS
SAGSGTPLSSVSTPTSATMATSSGGGGGGGGNAGGGSSTTPASNPLLLMSGGTAGGGTGA
TTTTSTSSSSRMMSSSSSLSSQMAALEAAARDNDDETPSPSGENTNGSGGSGNAGGMASK
GKLDSIKQDDDIKKEFMDDSCGGNNDSSQMDCSTGGGKGKNVNNDGTSMIKMEIKTEDGL
DGEVKIKTEAMDVDEAGGSTAGEHHGEGGGGSGVGGGKDNINGAHDGGATGGAVDIKPKT
ETKPLVPEPLAPNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGI
PDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLS
EVFEAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNSLKEYGVASN
RYTYCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVNCQECGRKQHQ
ICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAG
AGEVHIRVVSSSDKCVEVKPGMRRRFVEQGEMMNEFPYRAKALFAFEEVDGIDVCFFGMH
VQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWA
CPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGS
AAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKK
GQKKAKKSNKSKAAQRKNSKKSNEHQSGNDLSTKIYATMEKHKEVFFVIRLHSAQSAASL
APIQDPDPLLTCDLMDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYT
CNHCKTAVETRYHCTVCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHKQANPQEA
RKQSIQRCIQSLAHACQCRDANCRLPSCQKMKLVVQHTKNCKRKPNGGCPICKQLIALCC
YHAKNCEEQKCPVPFCPNIKHKLKQQQSQQKFQQQQLLRRRVALMSRTAAPAALQGPAAV
SGPTVVSGGVPVVGMSGVAVSQQVIPGQAGILPPGAGGMSPSTVAVPSPVSGGAGAGGMG
GMTSPHPHQPGIGMKPGGGHSPSPNVLQVVKQVQEEAARQQVSHGGGFGKGVPMAPPVMN
RPMGGAGPNQNVVNQLGGMGVGVGGVGGVGVGGVGGVGVNQLNSGGGNTPGAPISGPGMN
VNHLMSMDQWGGGGAGGGGANPGGGNPQARYANNTGGMRQPTHVMQTNLIPPQQQQQMMG
GLGGPNQLGGGQMPVGGQHGGMGMGMGAPPMAGTVGGVRPSPGAGGGGGSATGGGLNTQQ
LALIMQKIKNNPTNESNQHILAILKQNPQIMAAIIKQRQQSQNNAAAGGGAPGPGGALQQ
QQAGNGPQNPQQQQQQQQQQQVMQQQQMQHMMNQQQGGGGPQQMNPNQQQQQQQVNLMQQ
QQQGGPGGPGSGLPTRMPNMPNALGMLQSLPPNMSPGVSTQGGMVPNQNWNKMRYMQMSQ
YPPPYPQRQRGPHMGGAGPGPGQQQFPGGGGGAGNFNAGGAGGAGGVVGVGGVPGGAGTV
PGGDQYSMANAAAASNMLQQQQGQVGVGVGVGVKPGPGQQQQQMGVGMPPGMQQQQQQQQ
PLQQQQMMQVAMPNANAQNPSAVVGGPNAQVMGPPTPHSLQQQLMQSARSSPPIRSPQPT
PSPRSAPSPRAAPSASPRAQPSPHHVMSSHSPAPQGPPHDGMHNHGMHHQSPLPGVPQDV
GVGVGVGVGVGVNVNVGNVGVGNAGGALPDASDQLTKFVERL
Download sequence
Identical sequences M9MS40
NP_001188575.1.81976 FBpp0291862 FBpp0291862 FBpp0291862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]