SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9MSI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9MSI4
Domain Number 1 Region: 13-324
Classification Level Classification E-value
Superfamily L domain-like 1.59e-48
Family Ngr ectodomain-like 0.065
Further Details:      
 
Domain Number 2 Region: 324-417
Classification Level Classification E-value
Superfamily L domain-like 0.000000442
Family Internalin LRR domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M9MSI4
Sequence length 564
Comment (tr|M9MSI4|M9MSI4_DROME) Uncharacterized protein, isoform B {ECO:0000313|EMBL:ADV37055.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG18095 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MYLLPGSLLLLIFSFSPRLSCLQLSKCNNTEVTLIRKTELLTSLTLSNCTLPHVENGFFV
RFDHLLHLELQHSGLSDLDDFSLNGLTKLQYLSLSHNNLSSLRSWSSEPLGALTNLDLSH
NMLSKLSVKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFR
GLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRGLARLVHLNLSS
NLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLD
SLIALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISSQMMFNQNHLRYIKLSG
NAISDAAFLDRLSPSVNRFTLYVDLSSNRLKSLNLSSLLHFRYINLADNNWSCNWLVANL
VQKLPNSVNFARPWTVINNLSENTTNVEGIDCIEGGTNRSIILLDVSGVPQPKSDNCDCV
VAYDETNPSPPPLTWPKIPTDRFDSRSVIIWMLVAIAIAFSGLRWLRRFVDRNEKRKLGQ
KMLHNVYVSKVQWQAIRTDPDQRS
Download sequence
Identical sequences M9MSI4
FBpp0292334 FBpp0292334 FBpp0292334 NP_001188805.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]