SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9PB92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9PB92
Domain Number 1 Region: 6-68
Classification Level Classification E-value
Superfamily RING/U-box 1.1e-16
Family RING finger domain, C3HC4 0.0000688
Further Details:      
 
Domain Number 2 Region: 102-189
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000819
Family Canonical RBD 0.0000948
Further Details:      
 
Weak hits

Sequence:  M9PB92
Domain Number - Region: 191-220
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00171
Family CCCH zinc finger 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M9PB92
Sequence length 1062
Comment (tr|M9PB92|M9PB92_DROME) CCR4-NOT transcription complex subunit 4, isoform K {ECO:0000313|EMBL:AGB92878.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG31716 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MNGLSSNDDAVECPLCMEPLEVDDLTFFPCTCGYQICRFCWHRIRTDENKLCPACRKEYP
ENPADFKPLSQEEMIAFKSQKRQRDQQRKQKITENRKHLANVRVVQKNLVFVVGLPPRLA
DADILKKHEYFGKYGKIHKVVINPSTTYAGVQVRVGPSASAYVTYVNNSDALRAIQSVNN
IMIDGRLIKTSLGTTKYCSHFMKNQQCPKGDCMYLHELGDPEASFTKEEMHQGKHLEYEK
RLHDTLIASLGPNATGIVNGNGASKANVAIPSSSSASSSSSGSGTNGSSASGNAQQKEAW
PSLSVSPINGKEAAATATSSSGKSKREKLRNEKRHEKNKAKNKNGSNTNANASNKENYVP
ETRSSTSTETFAEATADAPASTKAEPPQASSNRTRADRGKDRTTASAKEQKKSKEAAPAP
AASKPAERVETSESTIRQKKAEVTESCEDNLPQKRLAGTNVQRSVSSCSENSEGHVSESS
LSEKSLTGDYVEEKCNSVNSESQQESVKFQEELEKSNEAIVEAETILPTAESSEDISPAA
VAPGNGEVEGCLPVVDPVEPPSLADNGSRVTDALSKLNIFDDTPSFFTSPSFQQAPILKN
KLDLEMRQSHLPDLVNDIDGIQKASNTNEWEEAFKNVMMGNTQHMEEQLLQQQHLQQHQN
LRHQLVLQQEEFLRMQELQKRNNFATQINGPANDFLRAYELRAQANAIIQQQLLQQHAGE
NLFGGNMSKFFDFHKSQPQSHHQYLNGHPPQINGNGAVPEPQRVAASLESNRLNSPFVEN
GLINSQQQQQQQQQQQKQRMMGMYEFMPPNTQSQQNRFTQNSIVDDDLGFDPFVETQKGL
AELMENEVVQKQSINNENPLPKLPPQPQVPPHPQLVDNLQRARMPPPGFNHVNTLGLGGA
SRLQLTSKIIPFMNMPVNGVGNSGAQGQHQMPMGVNWNAPMGMHQNPGQPVGDSQLQHPM
AHNKVYNNSDWTSMDPAILSFRQYSSFPQNQIPPHPQQQQDLFLQHLAQQQNSQSGGFNN
QAQQMLPMGMPNSLLNGQQTQPPQVNANVQGMLEFLKSRQFV
Download sequence
Identical sequences M9PB92
FBpp0304028 NP_001260343.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]