SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9PE16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9PE16
Domain Number 1 Region: 581-955
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.84e-99
Family Hect, E3 ligase catalytic domain 0.0000049
Further Details:      
 
Domain Number 2 Region: 229-328
Classification Level Classification E-value
Superfamily E set domains 0.000000000801
Family Filamin repeat (rod domain) 0.024
Further Details:      
 
Weak hits

Sequence:  M9PE16
Domain Number - Region: 37-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000471
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M9PE16
Sequence length 962
Comment (tr|M9PE16|M9PE16_DROME) CG4238, isoform H {ECO:0000313|EMBL:AGB92432.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG4238 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MLKRSLKVLIAVVLSLMFTVSLVKIVLLIWSSHPAAPHSAPPLPTVDEWLESENLASYKH
LFRDKGISSLSSCGDPERLPELPPLDEQRLQRAALHLQQKLILREWLKDHRLQHHYQRLL
AVEVASLEDVYWLEDSRASKILGKDWQLWSGARQNLPTSKAQLDALKAQLWSTVVKSSQH
QDAWTWGGMLVVSVSVAGLVTLAAMTQPSLAPEARHSLLQYVTGKYLLPANCKVQWDWKD
PASVGGTMCFVVRFFQRNGQPYPICDTDHFFVEVTEGTRKVVTISELGSSTDPNNANIAK
VKFTVRTAGQYKISVLIGASHIAGSPFLRSFLPGAIDARRSRFIRPASTVICCAGAPTLM
HIEPRDEFGNSCLFDQNQSDEALQGYQVAIYDLHGVPVEKLQHAIVFAYDKVNSRVSVTA
LFPEPTCLRAVISYRDQQLPNGDFDIIVLSSSDTTLVHKNIASRKHNICYEAKLLSIFGV
SKNKPRKVLCYVGPKQVTIKEMILKFIPKRIATFRLCPSTKFHFLPQLVSQLHGPVFIID
DGAQPKIELASKDRNIIAATFTHFLLKNIGGSETFKDKQDFFYHEVRKFHASYYHEKMAL
KVQREKILESSMKAVKGFSVSDWCGNFEVTFQGEQGIDWGGLRREWFELVCSALFDARGG
LFCTFHDKHQALVHPNPTRPAHLKLKHFEFAGKMVGKCLFESALGGTYRQLVRARFSRSF
LAQLIGLRVHYKYFEQDDPDLYLSKIKYILDTDLDATDTLELYFVEEMYDSSSGQLSKTI
ELIPNGAKTRVTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLLSIFDENEL
ELLMCGTGEYSISDFKAHHIANGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQL
PPGGFQELNPQFQITAAPTFGNLPTAHTCFNQLCLPDYESYEQFEKSLLLAISEGSEGFG
MV
Download sequence
Identical sequences M9PE16
NP_001259895.1.81976 FBpp0303522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]