SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9PFB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9PFB5
Domain Number 1 Region: 341-419
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.01e-16
Family PCI domain (PINT motif) 0.047
Further Details:      
 
Weak hits

Sequence:  M9PFB5
Domain Number - Region: 98-187,234-343
Classification Level Classification E-value
Superfamily TPR-like 0.000531
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M9PFB5
Sequence length 444
Comment (tr|M9PFB5|M9PFB5_DROME) Alien, isoform E {ECO:0000313|EMBL:AHN54285.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG9556 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSDNDDDFMCDDDEDYGLEYSEDSNSEPDVDLENQYYNSKALKEEEPKAALASFQKVLDL
ENGEKGEWGFKALKQMIKINFRLCNYDEMMVRYKQLLTYIKSAVTRNHSEKSINSILDYI
STSKNMALLQNFYETTLDALRDAKNDRLWFKTNTKLGKLYFDRSDFTKLQKILKQLHQSC
QTDDGEDDLKKGTQLLEIYALEIQMYTVQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRE
CGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEA
KPYKNDPEILAMTNLVNSYQNNDINEFETILRQHRSNIMADQFIREHIEDLLRNIRTQVL
IKLIRPYKNIAIPFIANALNIEPAEVESLLVSCILDDTIKGRIDQVNQVLQLDKINSSAS
RYNALEKWSNQIQSLQFAVVQKMA
Download sequence
Identical sequences A0A1W4WDJ4 B3N7W4 B4HYU0 B4NXL4 B4Q7C6 M9PFB5 Q94899
NP_001260276.1.81976 NP_001285771.1.81976 NP_523517.1.81976 NP_723438.1.81976 XP_001969266.1.56816 XP_002036297.1.34323 XP_002078735.1.80810 XP_002088893.1.41174 XP_015015016.1.56816 XP_016973864.1.97277 XP_017006324.1.47939 XP_017033957.1.37106 XP_017062342.1.74164 XP_017076108.1.81094 7227.FBpp0079381 7245.FBpp0255653 IGBMC-0066-000 FBpp0255653 FBpp0079381 FBpp0089195 FBpp0079381 FBpp0194060 FBpp0220770 FBpp0079381 FBpp0089195 FBpp0303869 FBpp0142586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]