SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9PFS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9PFS6
Domain Number 1 Region: 1000-1310
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-66
Family Tandem AAA-ATPase domain 0.0000663
Further Details:      
 
Domain Number 2 Region: 746-998
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.82e-60
Family Tandem AAA-ATPase domain 0.0000386
Further Details:      
 
Domain Number 3 Region: 1410-1532
Classification Level Classification E-value
Superfamily Bromodomain 6.41e-30
Family Bromodomain 0.0013
Further Details:      
 
Domain Number 4 Region: 636-714
Classification Level Classification E-value
Superfamily BRK domain-like 3.01e-22
Family BRK domain-like 0.0021
Further Details:      
 
Domain Number 5 Region: 280-355,400-453
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00000000602
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M9PFS6
Sequence length 1658
Comment (tr|M9PFS6|M9PFS6_DROME) Brahma, isoform E {ECO:0000313|EMBL:AGB94599.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG5942 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MASPSPANSPMPPPQAPSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPGHPGAYGHPMQ
HGPPGQGPPGHHMPPHHQGMIFSKGPHMGMQMPPTGPNMSPYQTHGMPPNAPTQPCIVSP
GGPPGGPPPPERSSQENLHALQRAIDSMEEKGLQEDPRYSQLLAMRATSKHQHLNGNQVN
LLRTQITAYRLLARNKPISMQMQQALQAAQQQPPPGPPIGPPGAPGGPPPGSQHAGQPPV
PPQQQQQPPPSAGTPPQCSTPPASNPYGPPVPGQKMQVAPPPPHMQQGQPLPPQPPQVGG
PPPIQQQQPPQQQQQQSQPPPPEPHQHQLPNGGKPLSMGPSGGQPLIPSSPMQPQVRGTL
PGMPPGSQVPQPGGGPQRQVPPAGMPMPKPNRITTVAKPVGLDPITLLQERENRIAARIS
LRMQELQRLPATMSEDLRLQAAIELRALRVLNFQRQLRMEFVQCTRRDTTLETALNIKLY
KRTKRQGLREARATEKLEKQQKLEAERKRRQKHLEFLAAVLQHGKDLREFHRNNKAQLAR
MNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDE
YISNLTQMVKQHKDDQMKKKEEEGKRLIQFKKELLMSGEYIGIDEGSIVADMRVHVVEQC
TGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDSCGSNDDHKPKVEEQPTATEDATDKA
QATGNDEDAKDLITKAKVEDDEYRTEEQTYYSIAHTIHEKVVEQASIMVNGTLKEYQIKG
LEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLE
FEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVLLTTYEYVIKDKAVLAKIQWKYMIID
EGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQ
WFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMS
ALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQHIEEKYCD
HTGGHGVVSGPDLYRVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFG
YLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQ
DLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSE
RQQFLQTILHQDDNEEEEENEVPDDEMINMMIARSEEEIEIFKRMDAERKKEDEEIHPGR
ERLIDESELPDWLTKDDDEVERFHYQYDEDTILGRGSRQRKEVDYTDSLTEKEWLKAIDD
GAEFDEEEEEDDSKRKRRKRKNRKEESDDDSLILKRRRRQNLDKRSKKQMHKIMSAVIKH
NQDGRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIEDCKYADLNELEKDFMQLCQ
NAQIYNEEASLIYLDSIALQKVFVGARQRITAAADAAAVAAGDNTGEAHGNGGSDNSDND
DDDGGDDGSDDEEIATTSAAAVKMKLKLNKSLASAPATPTQSSSNVSSGAATTSKKQTRR
KRSQKKYTISDDDDDDMDXLPLGVIFKRGSSDVEGMGN
Download sequence
Identical sequences M9PFS6
FBpp0303193 NP_001261906.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]