SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9PGM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9PGM0
Domain Number 1 Region: 286-316,371-403
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.000000418
Family RILP dimerisation region 0.0084
Further Details:      
 
Weak hits

Sequence:  M9PGM0
Domain Number - Region: 217-304
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0732
Family Seryl-tRNA synthetase (SerRS) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M9PGM0
Sequence length 486
Comment (tr|M9PGM0|M9PGM0_DROME) Uncharacterized protein, isoform C {ECO:0000313|EMBL:AGB94979.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG11448 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPGFHLNEMGEMVLDAIDDIGVVDVYDLASDIGKEYERIMDRFGTDAVSGLMPKIINTLE
LLEALATKNERENATIQELRDKVAQLESEKLEKAEFRRRFDKELELIEEQWRSETNELVD
LVSSLQDENKRLVKQTQDLQSSSAQSSGLGASLTESIISMTNHELHSALSDTQVLQRLKE
QIYKQRDELKHRERELQDKYSELEHLNIQAERLKASERDTRRRHKLMQAQVKTLCEERAD
FLAQLQDQSREINQLRKRLGLAEKENEDLVASYDDGQNDPNRPRYTTRELKELISERDEL
LTTIDTLNEQLAELKPPSQAKGKRQRHFSSSDDSDEDDDGHVADNDDDDDEEEAAAEANE
LEPPAAGETPPGHDAPVQGPLPYEPDDAPWKKSSESGIRKFFRKLFSDPSDGSNTFPKRS
LATLSKMALSATPGSVSASAAANLGNSLYLTLSLAIHLLRLSCTYIVYTLDCCALIILSC
YAILFT
Download sequence
Identical sequences M9PGM0
FBpp0304571 NP_001259133.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]