SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9PHR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9PHR5
Domain Number 1 Region: 745-1029
Classification Level Classification E-value
Superfamily ARM repeat 1.41e-23
Family Armadillo repeat 0.0098
Further Details:      
 
Domain Number 2 Region: 1024-1101
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.98e-16
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 
Domain Number 3 Region: 1173-1316
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000000000000719
Family Toll/Interleukin receptor TIR domain 0.007
Further Details:      
 
Domain Number 4 Region: 1105-1167
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000024
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M9PHR5
Sequence length 1704
Comment (tr|M9PHR5|M9PHR5_DROME) Ectoderm-expressed 4, isoform K {ECO:0000313|EMBL:AGB94251.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG43119 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MNSPQLAPTTAQSHHAESADKTAPPGNKYAPGRRLAARQTLRLAIPKAQPGDPLNHPTSV
GLFRPSPSQLPPAPILKRVPAVSGGCSGIPKSASPLESHHLPNVTPTNAHTRLGYGMQGA
GGGSSCSSASSASNFLGVRKPSLTLNSSDIRNNNDLFAFPKDMSPVMSEHCHSPMFTDLS
SANSNGSPTHHQQLGRLFSLSPSSIRSYGNMTDFSDSSPSGVLSPPTSLIENFHKKNSSP
QPLGSSSAISTLTPTTLNGSVVGGGVGGAGHHSIENGRQINTSSSSCSSLKETSHQSTST
SQQVVNSSSSTTTRVEKKSQRLHHHITSSSSSSSTTQALSTSSEMKAAEIKRDLTNIQKS
MSEINDLAKERITGGPGSISTTSASAITAPSTMSQTTTSRLAPKLTSAHPSIDDLRGLSR
QDKITQLQKKIRASFENLVDHDDSNVIVTLPDDDDCPHNHFGSGLNLTHPTAAQLSASGL
SGSSKTIDTIKFQEKSMKTESKTKVVTDGFSSEQATSNSAEMKRLQAGDIDYQESKGASA
MRNRLEVDGVKTEENAAVIKEALSLRTGDITQQASNNVAASSITVQSENFSADKKAISQS
QQSQTMTSNGIISQEKHVSSASQANYSMSHKGVSSTGSSMITSSSQMSAMNGQMLKLADL
KLDDLKSLTAGSGQQEIEQTINKYSNMLTSIVSSLQEDERGGSAITVHDVGGKKSQYLEK
INEVIRRAWAVPTHGHELGYSLCNSLRQSGGLDLLMKNCVKPDLQFSSAQLLEQCLTTEN
RKHVVDNGLDKVVNVACVCTKNSNMEHSRVGTGILEHLFKHSEGTCSDVIRLGGLDAVLF
ECRTSDLETLRHCASALANLSLYGGAENQEEMILRKVPMWLFPLAFHNDDNIKYYACLAI
AVLVANKEIEAEVLKSGCLDLVEPFVTSHDPSAFARSNLAHAHGQSKHWLKRLVPVLSSN
REEARNLAAFHFCMEAGIKREQGNTDIFREINAIEALKNVASCPNAIASKFAAQALRLIG
ETVPHKLSQQVPLWSVEDVQEWVKQIGFNDYIDKFNESQVDGDLLLKLNQDNLRADIGIG
NGILLKRFERELQNLKRMADYSSKDTAKMHQFLSEIGTDYCTYTYAMLNAGIDKCALPHV
NEDMLMTECGIHNSIHRLRILNAVKNLENSLPSSSEENMAKTLDVFVSYRRSNGSQLASL
LKVHLQLRGFSVFIDVERLEAGKFDNGLLNSIRQAKNFVLVLTPDALHRCINDEDCKDWV
HREIVAALNSNCNIIPIIDQQFDWPEVERLPEDMRSVAHFNGVNWIHDYQDACIDKLERF
LRGEKNIDRIAAMVPGTPGSVSYQRMHSNDSDYQSGGAGAGSGAGTGGGGGGGVTGSVVD
GLMVAANGSGQANHQANRYRQSPSPARQRGSTSQLSGYSRAPSKRSQILTPYRTQQAALL
HKTGAGSASMQNMMPLAYLPPRRSSAAGLGHGSGSGMGSGYRSHSVDGLLDQAGSTPEQR
IAAAAAKVTAGSTALTNASSTSTLQPEEEVTDAALNDSVTRRDKHTLSPPGNVQQHRKSR
SLDHILSKQTLAELLPPSSELADGTQSMQNLAIPMTPQPQRRDTSSSSKSPTPERPPQPA
MERVRERQSPEGVSATESEREDQPEECLRHGNQQRASASVHRGASLTSNKTSNSSLGSNF
SAGGNNKTIFNRTMKKVRSLIKKP
Download sequence
Identical sequences M9PHR5
NP_001261556.1.81976 FBpp0306073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]