SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9PI81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9PI81
Domain Number 1 Region: 556-760
Classification Level Classification E-value
Superfamily NTF2-like 2.08e-33
Family NTF2-like 0.0064
Further Details:      
 
Domain Number 2 Region: 404-549
Classification Level Classification E-value
Superfamily L domain-like 4.76e-16
Family mRNA export factor tap 0.0069
Further Details:      
 
Domain Number 3 Region: 164-285
Classification Level Classification E-value
Superfamily L domain-like 0.0000000306
Family Internalin LRR domain 0.051
Further Details:      
 
Domain Number 4 Region: 776-824
Classification Level Classification E-value
Superfamily UBA-like 0.0000015
Family TAP-C domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M9PI81
Sequence length 825
Comment (tr|M9PI81|M9PI81_DROME) Nuclear RNA export factor 2, isoform C {ECO:0000313|EMBL:AGB94646.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG4118 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPNQMRVLDFGDGSVPIQLDYPDSKIFSKCSSYGDRVPGTHWNEITVHHKGRLEYSPNPE
QIILDALYQAIDGADFFPVFYQRGKNMDTMLVRNCKAAIDKLFKQRLSINLKGGASIPIS
IQLGVAQYQRHQITPTFHIARVVTRLMKQLIQRDGVDGLLNLDNFGSHPEFKNLVVSLGN
PSILMNVCQVIHNDDNERFRLNGFILSNNRIRDIRPLTLLANVDYALLDLRGNKIKSAER
LCRALEQFRARELLLENNPIVKISNFPANIKSLESNFELVDGKPFNMLHKIFSPLDVEID
LEVDGARIDTNNMWKLPEFENSQHWHAFMIPDPSHEFNQEVFFDFFFIRLDPTLSNFYPC
YYKIAHLVNNCNLEMTIPTGDRIFRYYLRMNVSTVKQHHVDPEECIQKAVSQCYVAQNRM
LNLERFHSRECLKDVMVSLSSPKILTYVLSVASRKFMTTCSEIRLCHNKVLVLDGAHVLG
MMGCLRAVDLSHNWVQDLSSIHSLGNLPLKSLVLHGNKLCRNYRLPSEYVRAVKEVFPQL
TTLDGVDLQTNPGQSLQKNFLCDTGAYELVGAFLENYLREFENDEFRHNLYKYYSENSIF
TLTCNYNVVQNHQTPKILQRLSKYNRHARNLRNKDYSKASDGVFFGCTYIVEILLQLPRV
THDFHSLQTDVMHYNGKGAVIYVAGLLRDEPPSTRNGHGSKTDIGGVLLGFSRQFVVTFD
EANLGLGKRARRLKIANERLHITNPSKTAIRNAFSVNFPDPSERQAEEDSLDVKDHKLLL
FQEVTGLISTWVTSIVEEADWDFERALKLFIQKNADHEIPDLAFA
Download sequence
Identical sequences M9PI81
NP_001261953.1.81976 FBpp0303951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]