SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9RF29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9RF29
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.99e-33
Family Thioltransferase 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M9RF29
Sequence length 119
Comment (tr|M9RF29|M9RF29_9RHOB) Glutaredoxin {ECO:0000256|PIRNR:PIRNR005894} KW=Complete proteome; Reference proteome OX=391626 OS=Octadecabacter antarcticus 307. GN=OAN307_c28370 OC=Rhodobacteraceae; Octadecabacter.
Sequence
MTAETQIKETVTANDVVLFMKGTKSMPQCGFSSRVAGVLNFMGVEFADVNVLADEDLRQG
IKDYSDWPTVPQLYVKGEFVGGCDIITEMTMSGELDALFAENGVTYDKDAAEKIREANT
Download sequence
Identical sequences M9RF29
WP_015500401.1.44912 gi|478183969|ref|YP_007705039.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]