SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9VTT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9VTT0
Domain Number 1 Region: 36-330,367-386
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.29e-75
Family Duffy binding domain 0.0000552
Further Details:      
 
Domain Number 2 Region: 390-525
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.47e-28
Family Duffy binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M9VTT0
Sequence length 525
Comment (tr|M9VTT0|M9VTT0_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:AGJ83319.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
SVLKDVCDINKEHTNVQDTPGYTYDEPCEGKDSGREMFKIENGWKSGTDINKKHAEDVFL
PPRRQHFCTSNLEKIDDNFVTQNTKDHVNDTFLVDVLLAAKEEADYIKNNYKDTNDQEGK
CRALRYSFADIGDIIRGRDIWDEETGMKKIREYLPTIFGTIKDKVPGKYDKDSPDYIKLR
EDWWEANRDQIWKVMTCPSTPPRGSNPPCSDKEPTPLVDYIPQRLRWMTEWAEWYCKIQK
KAYEQLERKCGECRSGKCETEKNCKECKAKCKEYKEKITPWKQQWEKMSKKYKTLYEKAK
QYSGDTSPSEVKDEKDVVAFLKKLHEKNCENNTIYATAAGYIHQEAKYIHCNIQTEFCKK
KNGGTQVNEKYAFRTQPHDYDDACICNIRYSEKDVLKKPCDIVDEIFNTGDGINKIGSCE
SKKYESYPERKCDKQSQLVREDGIYMSPRRQELCVHYLRTFSDKTQKGLREAFIKSAAAE
TFLSWNYYKRKNGDAVNIELQAGIIPPEYLRSMFHTFGDYRDICL
Download sequence
Identical sequences M9VTT0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]