SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9VYB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9VYB5
Domain Number 1 Region: 4-350
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.01e-73
Family Duffy binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 427-566
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-33
Family Duffy binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M9VYB5
Sequence length 566
Comment (tr|M9VYB5|M9VYB5_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:AGJ83316.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
SVLKDVCKITKDHSNSTPGQTEGPCAGKDSKNKMFEMEYGWTPTSSKSITHNDVYMPPRR
EHICTSNLEFLETYNKPLNGMEIVKNGKNGKLVNDSFLGDVLLSAKYEAENIKKKYENQP
GYNEGETMCRAIKYSFADLGDIIRGRDRWDLDVGSNKMDVILKNIFGTLYKSLDGIKENP
QYADDERNIPAYKLLREDWWEANRHQIWKAMKCTTKNINNNKCNGIPIEDYIPQRLRWMT
EWAEWYCKMQSQEYDKLKEGCKLCMGNDKSKTCWKNSPKCTSCTAASDAYKEKVDLWRIQ
WETISEKYQKLYEEARIHAFNGGPDYYNTEVPKEDQSVYDFLYYLHLQNGGKRGPPDDIH
GGTSRDIHDKRDATDDTPSTVYSTPEGYIHQEAHISDCKEQTHLCNKNSDDSDKEYAFRS
VPHDQDTACDCKKWTKKTDACTIVTNLVKNNDGEKKINGCGTKTNVTYPEWKYHNSSGLV
REDGVCMPPRRQKLCLHYLTKLNNLKSKEDIRKNFITCAVIETHFAWDRYKTKNLGAVDQ
LKNRKIPDEFKRQMFYTFGDYRDICL
Download sequence
Identical sequences M9VYB5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]