SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N1JM70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N1JM70
Domain Number 1 Region: 66-206
Classification Level Classification E-value
Superfamily PH domain-like 3.28e-49
Family Ran-binding domain 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) N1JM70
Sequence length 222
Comment (tr|N1JM70|N1JM70_BLUG1) Ran-specific GTPase-activating protein 1 {ECO:0000313|EMBL:CCU81705.1} KW=Complete proteome; Reference proteome OX=546991 OS=(Oidium monilioides f. sp. hordei). GN=BGHDH14_bgh01934 OC=Erysiphales; Erysiphaceae; Blumeria.
Sequence
MFSASSAFVGAADNMFSMFGGGAKKERKDDEDRGDNSGSAKAKREAEKEAAKEENNEEKD
ETPESEDVHFEPVIRLTEKVETKTNEELEEQTFKMRAKLFRFVKESNEWKERGTGDVRLL
KHKENGKTRLVMRRDKTLKVCANHYVVPDMKLSPNVGSDRSWVWNAAADVSEGEPEAQTL
AIRFANSDNANLFKEAFLKAQKENEALFSKTAEVEETAGEKP
Download sequence
Identical sequences N1JM70
CCU81705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]