SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N1NTC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N1NTC6
Domain Number 1 Region: 164-326
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.65e-27
Family Nuclear receptor ligand-binding domain 0.0043
Further Details:      
 
Domain Number 2 Region: 41-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-25
Family Nuclear receptor 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N1NTC6
Sequence length 336
Comment (tr|N1NTC6|N1NTC6_CAEEL) Nuclear Hormone Receptor family {ECO:0000313|EMBL:CCW45962.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_R07B7.13 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSEESNSFLPDIKVDERYCESTSNSQQSEITNETSRNVLPEKCEVCGNPAVGYHYDVATC
NGCKAFFRRTVITGRRVICRRRKNCLVEMEPKNRRICPGCRFSKCEEVGMNPRAIRAEIS
SGGKILKDELIAKREPRSKIMLSPKSKENEVSRLISDLNLIENQIDELFNSSLPINYGDW
RTLSEIIQMKPYLKVSKIPNLKLIRNQMNAELAGYAHNGSLAMVEYAKMLDFFPKISKET
AIKLVKHGLFMCGSLSFSRRSIQKYNSDILRFTDGSVAGKPKTNWNGVMLDHRRIAQKTL
HSILRVKLDYVEYLFLKAITMCNPDLIMHKAFSIIV
Download sequence
Identical sequences N1NTC6
NP_001294679.1.50509 R07B7.13b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]